Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.49
PubTator Score 12.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 1.4e-03
Astrocytoma, Pilocytic 1.100 3.0e-05
atypical teratoid / rhabdoid tumor 1.200 9.1e-06
ependymoma 1.200 2.2e-10
glioblastoma 1.500 3.5e-06
intraductal papillary-mucinous adenoma (... -1.100 1.7e-03
non primary Sjogren syndrome sicca 1.100 2.4e-02
osteosarcoma -2.339 2.5e-06
ovarian cancer -1.100 2.9e-05
primitive neuroectodermal tumor 1.200 1.1e-04

Gene RIF (5)

AA Sequence

MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQA      1 - 70
GQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPD     71 - 140
SLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTP    141 - 210
AAHKYYYSEVSD                                                              211 - 222
//

Text Mined References (17)

PMID Year Title