Property Summary

NCBI Gene PubMed Count 24
PubMed Score 158.56
PubTator Score 52.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (9)

PMID Text
26938916 Biochemical analysis of the BAHD1-associated multiprotein complex identifies MIER proteins as novel partners of BAHD1 and suggests that BAHD1-MIER interaction forms a hub for histone deacetylases and methyltransferases
26281834 Insulin and IGF-1 alter the subcellular localization of MIER1alpha in breast carcinoma cells.
24376786 nuclear targeting of MIER1alpha requires an intact ELM2 domain and is dependent on interaction with HDAC1/2
23277184 the first immunohistochemical study of the MIER1alpha protein expression pattern in human tissues, is reported.
22384264 Differential splicing alters subcellular localization of the alpha but not beta isoform of the MIER1 transcriptional regulator in breast cancer cells
18665173 Loss of nuclear MI-ER1 alpha might contribute to the development of invasive breast carcinoma
15117948 the association of hMI-ER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters
12482978 we investigated the role of hMI-ER1alpha and hMI-ER1beta in the regulation of transcription.We demonstrate that this repressor activity is due to interaction and recruitment of a trichostatin A-sensitive histone deacetylase 1 (HDAC1).
12242014 Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMI-ER1 proteins and this may have important implications for hMI-ER1 function.

AA Sequence

MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELL      1 - 70
SLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVA     71 - 140
SQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDD    141 - 210
QLLWDPEYLPEDKVIIFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKA    211 - 280
AREELSVWTEEECRNFEQGLKAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKY    281 - 350
NLHPGVTDYMDRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVK    351 - 420
VEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPG    421 - 490
SSEFFQEAVSHGKFEELENTDD                                                    491 - 512
//

Text Mined References (34)

PMID Year Title
26938916 2016 Role of the BAHD1 Chromatin-Repressive Complex in Placental Development and Regulation of Steroid Metabolism.
26281834 2015 Insulin and IGF-1, but not 17?-estradiol, alter the subcellular localization of MIER1? in MCF7 breast carcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24376786 2013 Nuclear localization of the transcriptional regulator MIER1? requires interaction with HDAC1/2 in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23277184 2013 Protein expression pattern of human MIER1 alpha, a novel estrogen receptor binding protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22384264 2012 Differential splicing alters subcellular localization of the alpha but not beta isoform of the MIER1 transcriptional regulator in breast cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19061646 2008 CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18665173 2008 Changes in subcellular localisation of MI-ER1 alpha, a novel oestrogen receptor-alpha interacting protein, is associated with breast cancer progression.
18451879 2008 Atrophin recruits HDAC1/2 and G9a to modify histone H3K9 and to determine cell fates.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15117948 2004 The SANT domain of human MI-ER1 interacts with Sp1 to interfere with GC box recognition and repress transcription from its own promoter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12482978 2003 Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242014 2002 Genomic organization of the human mi-er1 gene and characterization of alternatively spliced isoforms: regulated use of a facultative intron determines subcellular localization.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9813250 1998 Molecular cloning of human er1 cDNA and its differential expression in breast tumours and tumour-derived cell lines.