Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.56
PubTator Score 116.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1614 8.6e-14
ovarian cancer 8491 1.6e-04
invasive ductal carcinoma 2950 3.3e-02
Breast cancer 3098 3.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.100 3.9e-02
breast carcinoma 1.100 8.6e-14
invasive ductal carcinoma 2.300 3.3e-02
ovarian cancer 1.700 1.6e-04

Gene RIF (14)

PMID Text
26827826 In conclusion, this study revealed that miR-26b suppresses NSCLC metastasis by targeting MIEN1 via NF-kappaB/MMP-9/VEGF pathways, implicating a potential prognostic biomarker and therapeutic target for NSCLC treatment.
26272794 MIEN1, a novel interactor of Annexin A2, promotes tumor cell migration by enhancing AnxA2 cell surface expression.
26173296 C35 might serve as a biomarker or therapeutic target for management of colorectal cancer.
25996585 MIEN1 expression not only positively correlates with oral cancer progression but also seems to be a critical molecular determinant in migration and invasion of oral cancer cells.
25406943 While MIEN1 is a direct target of miR-940, miR-940 alters MIEN1 RNA.
23880825 results suggest that DeltaNp73 might cooperate with C35 to promote tumour progression and contribute to cisplatin resistance in ovarian cancer cells.
23284973 Results suggest that MIEN1 may have an important regulatory role in phosphorylation of AKT with its redox potential.
21628459 prenylation is required for the function of the C17orf37 protein in cancer cells
21068479 Inhibition of C35 gene expression by small interfering RNA induces apoptosis of breast cancer cells.
19503095 Data strongly suggest C17orf37 overexpression in prostate cancer functionally enhances migration and invasion of tumor cells, and is an important target for cancer therapy.
19124506 Observational study of gene-disease association. (HuGE Navigator)
17117180 Observational study of gene-disease association. (HuGE Navigator)
15010812 Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus.
12739007 MGC14832 gene is located within human chromosome 17q12 amplicon, including PPP1R1B, STARD3, TCAP, PNMT, ERBB2, MGC14832 and GRB7 genes. PPP1R1B ~ ERBB2 ~ GRB7 locus is amplified in human gastric cancer and breast cancer.

AA Sequence

MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN      1 - 70
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL                              71 - 115
//

Text Mined References (28)

PMID Year Title
26827826 2016 MicroRNA-26b suppresses the metastasis of non-small cell lung cancer by targeting MIEN1 via NF-?B/MMP-9/VEGF pathways.
26272794 2015 MIEN1, a novel interactor of Annexin A2, promotes tumor cell migration by enhancing AnxA2 cell surface expression.
26173296 2015 C35 is overexpressed in colorectal cancer and is associated tumor invasion and metastasis.
25996585 2015 MIEN1 promotes oral cancer progression and implicates poor overall survival.
25416956 2014 A proteome-scale map of the human interactome network.
25406943 2014 MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
23880825 2013 The interaction between C35 and ?Np73 promotes chemo-resistance in ovarian cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284973 2012 Solution structure of the oncogenic MIEN1 protein reveals a thioredoxin-like fold with a redox-active motif.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21628459 2011 Prenylated c17orf37 induces filopodia formation to promote cell migration and metastasis.
21483102 2011 An analytical approach differentiates between individual and collective cancer invasion.
21347235 2011 An in vitro model that recapitulates the epithelial to mesenchymal transition (EMT) in human breast cancer.
21269460 2011 Initial characterization of the human central proteome.
21068479 2010 Inhibition of C35 gene expression by small interfering RNA induces apoptosis of breast cancer cells.
20628393 2010 A gene on the HER2 amplicon, C35, is an oncogene in breast cancer whose actions are prevented by inhibition of Syk.
19503095 2009 Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
17503775 2007 SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin-like family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17121940 2006 C35 (C17orf37) is a novel tumor biomarker abundantly expressed in breast cancer.
17117180 2006 HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010812 2004 Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon.
12739007 2003 MGC9753 gene, located within PPP1R1B-STARD3-ERBB2-GRB7 amplicon on human chromosome 17q12, encodes the seven-transmembrane receptor with extracellular six-cystein domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.