Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.63
PubTator Score 7.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 9.0e-07
tuberculosis and treatment for 6 months 686 1.4e-04
lung cancer 4473 1.8e-02
Breast cancer 3098 2.6e-02
Disease Target Count Z-score Confidence
Optic atrophy 43 3.535 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 1.4e-04
lung cancer 1.100 1.8e-02
Breast cancer 2.700 2.6e-02
pituitary cancer 1.300 9.0e-07

 GO Function (2)

Gene RIF (9)

PMID Text
26903540 The results indicate that Drp1-dependent mitochondrial fission through MiD49/MiD51 regulates cristae remodeling during intrinsic apoptosis.
24817717 The cytoplasmic domain of MiD51 was overexpressed, purified and crystallized.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23880462 MIEF1 and MIEF2 are differentially expressed in human tissues during development
23283981 we find that either MiD49 or MiD51 can mediate Drp1 recruitment and mitochondrial fission in the absence of Fis1 and Mff
21701560 elevated MIEF1 levels induce mitochondrial fusion; depletion of MIEF1 causes mitochondrial fragmentation; MIEF1 interacts with and recruits Drp1 to mitochondria but inhibits Drp1 activity, executing a negative effect on mitochondrial fission
21508961 MiD49/51 are new mediators of mitochondrial division affecting Drp1 action at mitochondria.
21508961 Mitochondrial outer membrane protein that recruits fission mediator Drp1 to the mitochondrial surface.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRS      1 - 70
WEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLL     71 - 140
TYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVL    141 - 210
EQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG    211 - 280
SLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLR    281 - 350
ALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE    351 - 420
AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT                               421 - 463
//

Text Mined References (31)

PMID Year Title
26903540 2016 Drp1-dependent mitochondrial fission via MiD49/51 is essential for apoptotic cristae remodeling.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25416956 2014 A proteome-scale map of the human interactome network.
24817717 2014 Expression, purification, crystallization and preliminary crystallographic study of the cytoplasmic domain of the mitochondrial dynamics protein MiD51.
24515348 2014 Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23880462 2013 The mitochondrial elongation factors MIEF1 and MIEF2 exert partially distinct functions in mitochondrial dynamics.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21701560 2011 Human MIEF1 recruits Drp1 to mitochondrial outer membranes and promotes mitochondrial fusion rather than fission.
21508961 2011 MiD49 and MiD51, new components of the mitochondrial fission machinery.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10591208 1999 The DNA sequence of human chromosome 22.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.