Property Summary

NCBI Gene PubMed Count 5
PubMed Score 13.08
PubTator Score 4.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.700 1.5e-02
interstitial lung disease -1.400 2.0e-02
astrocytoma 1.200 7.2e-16
glioblastoma multiforme 1.300 6.9e-16
oligodendroglioma 1.200 2.7e-12
osteosarcoma -1.837 5.1e-04
primitive neuroectodermal tumor 1.300 2.9e-03
primary pancreatic ductal adenocarcinoma 1.029 6.9e-03
non-small cell lung cancer -1.189 8.7e-11
intraductal papillary-mucinous neoplasm ... 1.600 4.4e-03
diabetes mellitus -1.500 2.1e-02
group 3 medulloblastoma 1.100 2.3e-02
gastric carcinoma 1.100 4.8e-02

Synonym

Accession Q504T8 Q96BW8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

PMID Text
24187134 midnolin plays a role in cellular signaling of adult tissues and regulates glucokinase enzyme activity in pancreatic beta cells

AA Sequence

MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKER      1 - 70
LALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLT     71 - 140
LALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSP    141 - 210
ASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVF    211 - 280
SGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTT    281 - 350
SCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSP    351 - 420
SRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA                          421 - 468
//

Text Mined References (6)

PMID Year Title
24187134 2013 Identification of the ubiquitin-like domain of midnolin as a new glucokinase interaction partner.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.
10974535 2000 Novel nucleolar protein, midnolin, is expressed in the mesencephalon during mouse development.