Property Summary

NCBI Gene PubMed Count 5
PubMed Score 14.37
PubTator Score 4.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 7.2e-16
diabetes mellitus -1.500 2.1e-02
gastric carcinoma 1.100 4.8e-02
glioblastoma multiforme 1.300 6.9e-16
group 3 medulloblastoma 1.100 2.3e-02
interstitial lung disease -1.400 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 4.4e-03
non-small cell lung cancer -1.189 8.7e-11
oligodendroglioma 1.200 2.7e-12
osteosarcoma -1.837 5.1e-04
primary pancreatic ductal adenocarcinoma 1.029 6.9e-03
primitive neuroectodermal tumor 1.300 2.9e-03
Rheumatoid arthritis 1.700 1.5e-02

Gene RIF (1)

AA Sequence

MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKER      1 - 70
LALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLT     71 - 140
LALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSP    141 - 210
ASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVF    211 - 280
SGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTT    281 - 350
SCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSP    351 - 420
SRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA                          421 - 468
//

Text Mined References (6)

PMID Year Title