Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.15
PubTator Score 6.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.239 5.6e-03
ovarian cancer -1.500 2.0e-04
progressive supranuclear palsy -1.500 1.6e-02
psoriasis 1.100 9.0e-04
Waldenstrons macroglobulinemia 1.009 3.4e-02

Gene RIF (7)

AA Sequence

MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQ      1 - 70
KNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQ     71 - 140
TAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDL    141 - 210
MTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRK    211 - 280
EDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEF    281 - 350
KRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK    351 - 420
GVKEVWKQAGKGLF                                                            421 - 434
//

Text Mined References (25)

PMID Year Title