Property Summary

NCBI Gene PubMed Count 32
PubMed Score 303.80
PubTator Score 93.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (18)

PMID Text
26489515 Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells.
26336993 Data show that ribosomal protein S3 (RPS3) knockdown decreased mitochondrial calcium uptake 1 protein (MICU1) expression.
25824785 Loss of heterozygosity of MICU1 gene on chromosome 10q is associated with pancreatic cancer.
24560927 MICU1 and MICU2 have roles in tuning the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity
24503055 Expression of MICU1 mutants lacking functional Ca2+-binding sites leads to a striking loss of Ca2+ uptake in HEK293 cells.
24336167 Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling.
24332854 MICU1 EF hands determine MCU activity, but not binding.
23747253 Prolonged MICU1 loss leads to an adaptive increase in matrix Ca(2+) binding, yet cells show impaired oxidative metabolism and sensitization to Ca(2+) overload.
23667653 CBARA1 is a marker for undifferentiated human embryonic stem cells that plays a role in maintaining stemness, cell cycle progression, and proliferation.
23615904 MICU1 is a novel regulator of the machinery in cancer cells that prevents apoptosis.
23101630 MICU1 is a gatekeeper of mitochondrial calcium uniporter-mediated Ca(2 )uptake that is essential to prevent [Ca(2 )]overload and associated stress.
22904319 the crucial role of MICU1 and MCU in mitochondrial Ca(2+) uptake in pancreatic beta-cells and their involvement in the positive feedback required for sustained insulin secretion.
21685886 MICU1 physically interacts with MCU, a principal component of the mitochondrial calcium uniporter.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20693986 MICU1 represents the founding member of a set of proteins required for high-capacity mitochondrial calcium uptake
20693986 MICU1 (CBARA1) is an EF-hand containing protein associated with the mitochondrial inner membrane. It is required for mitochondrial calcium uptake in HeLa cells.
19919870 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDI      1 - 70
GDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEP     71 - 140
GEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYI    141 - 210
FLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTT    211 - 280
YFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLK    281 - 350
KHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALF    351 - 420
DCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ                  421 - 476
//

Text Mined References (41)

PMID Year Title
27123478 2016 Homozygous deletion in MICU1 presenting with fatigue and lethargy in childhood.
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26903221 2016 Functional roles of MICU1 and MICU2 in mitochondrial Ca(2+) uptake.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26489515 2015 Rearrangement of MICU1 multimers for activation of MCU is solely controlled by cytosolic Ca(2.).
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
26336993 2015 RPS3 regulates melanoma cell growth and apoptosis by targeting Cyto C/Ca2+/MICU1 dependent mitochondrial signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25824785 2015 Loss of heterozygosity at the calcium regulation gene locus on chromosome 10q in human pancreatic cancer.
24560927 2014 MICU1 and MICU2 finely tune the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity.
24514027 2014 Structural and mechanistic insights into MICU1 regulation of mitochondrial calcium uptake.
24503055 2014 MICU1 and MICU2 play nonredundant roles in the regulation of the mitochondrial calcium uniporter.
24430870 2014 SLC25A23 augments mitochondrial Ca²? uptake, interacts with MCU, and induces oxidative stress-mediated cell death.
24336167 2014 Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling.
24332854 2013 MICU1 motifs define mitochondrial calcium uniporter binding and activity.
24313810 2014 Dynamics of mitochondrial Ca2+ uptake in MICU1-knockdown cells.
24231807 2013 EMRE is an essential component of the mitochondrial calcium uniporter complex.
23747253 2013 MICU1 controls both the threshold and cooperative activation of the mitochondrial Ca²? uniporter.
23667653 2013 CBARA1 plays a role in stemness and proliferation of human embryonic stem cells.
23615904 2013 Probing novel roles of the mitochondrial uniporter in ovarian cancer cells using nanoparticles.
23178883 2012 MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
23101630 2012 MICU1 is an essential gatekeeper for MCU-mediated mitochondrial Ca(2+) uptake that regulates cell survival.
22925203 2012 Inactivation of Pde8b enhances memory, motor performance, and protects against age-induced motor coordination decay.
22904319 2012 Mitochondrial Ca2+ uptake 1 (MICU1) and mitochondrial ca2+ uniporter (MCU) contribute to metabolism-secretion coupling in clonal pancreatic ?-cells.
21685888 2011 A forty-kilodalton protein of the inner membrane is the mitochondrial calcium uniporter.
21685886 2011 Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20693986 2010 MICU1 encodes a mitochondrial EF hand protein required for Ca(2+) uptake.
19919870 2010 Cannabinoid CB1 receptor expression in relation to visceral adipose depots, endocannabinoid levels, microvascular damage, and the presence of the Cnr1 A3813G variant in humans.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16002733 2005 Hom s 4, an IgE-reactive autoantigen belonging to a new subfamily of calcium-binding proteins, can induce Th cell type 1-mediated autoreactivity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9806765 1998 Isolation of cDNA clones coding for IgE autoantigens with serum IgE from atopic dermatitis patients.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.