Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.23
PubTator Score 4.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.400 3.1e-06
esophageal adenocarcinoma 1.400 1.8e-02
psoriasis 1.300 3.3e-04
medulloblastoma, large-cell -1.900 1.4e-05
Atopic dermatitis 1.100 5.5e-04
intraductal papillary-mucinous adenoma (... 2.000 2.4e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-03
breast carcinoma 1.100 1.6e-03
fibroadenoma 1.200 2.4e-02
pilocytic astrocytoma 1.500 1.8e-06
lung adenocarcinoma 1.800 4.8e-08
progressive supranuclear palsy -1.200 1.3e-02
ovarian cancer 1.300 7.1e-05
pancreatic cancer 1.100 2.2e-02

Gene RIF (2)

PMID Text
25864591 Data indicate that MICAL-L2 may be an important regulator of epithelial-mesenchymal transition (EMT) in ovarian cancer cells.
17891173 Involved in epithelial cell scattering.

AA Sequence

MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAE      1 - 70
EHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAK     71 - 140
LPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHR    141 - 210
SCFRCKQCSCTLHSGAYKATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEAN    211 - 280
KARPSAWEPAAGNSPARASVPAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSS    281 - 350
AAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKF    351 - 420
FQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEA    421 - 490
PQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPM    491 - 560
AKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLKPKEPRALAEPRAGEAPRKVSGSFAG    561 - 630
SVHITLTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSWKEEEKK    631 - 700
PHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEG    701 - 770
DDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQEL    771 - 840
LEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKSSPSQ          841 - 904
//

Text Mined References (18)

PMID Year Title
25864591 2015 Silencing of MICAL-L2 suppresses malignancy of ovarian cancer by inducing mesenchymal-epithelial transition.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23890175 2013 Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17891173 2008 Involvement of Rab13 and JRAB/MICAL-L2 in epithelial cell scattering.
16525024 2006 JRAB/MICAL-L2 is a junctional Rab13-binding protein mediating the endocytic recycling of occludin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110185 2002 MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion.