Property Summary

NCBI Gene PubMed Count 24
PubMed Score 6.74
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.7e-02
esophageal adenocarcinoma -1.100 2.8e-02
psoriasis 1.500 8.1e-16
posterior fossa group A ependymoma 1.200 1.0e-06
glioblastoma 1.300 5.0e-03
primitive neuroectodermal tumor 1.500 1.6e-04
non-small cell lung cancer 1.213 1.8e-09
lung cancer 1.300 4.1e-03
pediatric high grade glioma 1.200 8.4e-04
group 3 medulloblastoma 1.300 7.2e-03
gastric carcinoma -1.500 1.4e-02
ovarian cancer 1.900 1.0e-05

Gene RIF (7)

PMID Text
25287187 suggesting an EHD1-independent function for MICAL-L1 earlier in mitosis
25248744 DGKalpha generates phosphatidic acid to drive its own recruitment to tubular recycling endosomes via its interaction with MICAL-L1
24481818 MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
23596323 Cooperation of MICAL-L1, pacsin 2 (syndapin2), and phosphatidic acid in tubular recycling endosome biogenesis.
21951725 Rab35 is a critical upstream regulator of MICAL-L1 and Arf6, while both MICAL-L1 and Arf6 regulate Rab8a function.
21795389 novel insights into the MICAL-L1/Rab protein complex that can regulate EGFR trafficking at late endocytic pathways.
19864458 These data implicate MICAL-L1 as an unusual type of Rab effector that regulates endocytic recycling by recruiting and linking EHD1 and Rab8a on membrane tubules.

AA Sequence

MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVA      1 - 70
EKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDV     71 - 140
AQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEG    141 - 210
TFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQI    211 - 280
PTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVP    281 - 350
KPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLE    351 - 420
SKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLAL    421 - 490
HASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSL    491 - 560
ASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSC    561 - 630
KENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEH    631 - 700
RGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPE    701 - 770
KDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFK    771 - 840
TMKMLKLLGNKRDAKSKSPRDKS                                                   841 - 863
//

Text Mined References (34)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25287187 2015 Novel functions for the endocytic regulatory proteins MICAL-L1 and EHD1 in mitosis.
25248744 2014 Diacylglycerol kinase ? regulates tubular recycling endosome biogenesis and major histocompatibility complex class I recycling.
24481818 2014 Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23596323 2013 Cooperation of MICAL-L1, syndapin2, and phosphatidic acid in tubular recycling endosome biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22284051 2012 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.
21951725 2012 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a.
21795389 2011 MICAL-like1 mediates epidermal growth factor receptor endocytosis.
21269460 2011 Initial characterization of the human central proteome.
20801876 2010 Collapsin response mediator protein-2 (Crmp2) regulates trafficking by linking endocytic regulatory proteins to dynein motors.
20106972 2010 Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19945174 2010 Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system.
19864458 2009 MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12788069 2003 MICAL-1 isoforms, novel rab1 interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110185 2002 MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion.
12058051 2002 The small GTPase Rab13 regulates assembly of functional tight junctions in epithelial cells.
11258795 2001 Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.
10591208 1999 The DNA sequence of human chromosome 22.