Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.11
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
pancreatic cancer 1.700 5.3e-03
malignant mesothelioma -1.700 2.0e-07
astrocytic glioma -3.200 1.9e-03
posterior fossa group B ependymoma -4.000 5.0e-10
oligodendroglioma -3.100 2.8e-16
glioblastoma -4.400 1.0e-06
osteosarcoma -1.193 3.8e-02
medulloblastoma -4.200 1.7e-08
atypical teratoid / rhabdoid tumor -5.000 8.2e-11
medulloblastoma, large-cell -4.000 9.8e-07
primitive neuroectodermal tumor -4.600 4.2e-05
adrenocortical carcinoma -1.157 7.0e-03
chronic kidney disease 1.100 4.5e-02
tuberculosis 1.200 8.4e-05
primary pancreatic ductal adenocarcinoma 1.620 8.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-02
lung cancer -1.100 4.9e-03
pediatric high grade glioma -3.500 1.3e-06
pilocytic astrocytoma -4.000 1.6e-07
pancreatic carcinoma 1.100 4.5e-03
subependymal giant cell astrocytoma -3.256 1.1e-02
invasive ductal carcinoma 1.494 6.5e-03
nasopharyngeal carcinoma 1.400 3.0e-05
inflammatory breast cancer 1.700 1.7e-03
lung carcinoma -1.300 1.4e-15
breast carcinoma 1.200 1.9e-21
Pick disease -1.600 3.1e-02
gastric carcinoma 1.300 2.6e-02
ductal carcinoma in situ 2.000 2.0e-04
ovarian cancer 3.500 1.8e-04
Down syndrome -1.100 1.3e-03
dermatomyositis 1.300 5.8e-03

Gene RIF (4)

PMID Text
24440334 These data show that SRF/MRTF-A signaling is regulated by MICAL-2-dependent redox regulation of nuclear actin.
22331357 although MICAL1 is auto-inhibited by its C-terminal coiled-coil region, MICAL2 remains constitutively active and affects stress fibers, suggesting differential but complementary roles for MICAL1 and MICAL2 in actin microfilament regulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16675569 MICAL2-PV is likely to be involved in cancer progression of prostate cancer and could be a candidate as a novel molecular marker and/or target for treatment of prostate cancers.

AA Sequence

MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLD      1 - 70
KRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGL     71 - 140
GAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHS    141 - 210
LSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKE    211 - 280
ETGIDLENIVYYKDCTHYFVMTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQ    281 - 350
LPSLDFAMNHYGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD    351 - 420
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYIT    421 - 490
KELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRP    491 - 560
ELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPVD    561 - 630
SWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSN    631 - 700
QECGSSKEGGNQNKVKSMANQLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATP    701 - 770
SPSPPLKRQFPSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL    771 - 840
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPPSPPSRLPSPD    841 - 910
PAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIGAAAEVLVNLYMNDHRPKAQA    911 - 980
TSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFHRECFRCSICATTLRLAAYTFDCDEGKF    981 - 1050
YCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLH   1051 - 1120
PLLG                                                                     1121 - 1124
//

Text Mined References (21)

PMID Year Title
26689989 2016 MICAL2 is a novel human cancer gene controlling mesenchymal to epithelial transition involved in cancer growth and invasion.
24440334 2014 Redox modification of nuclear actin by MICAL-2 regulates SRF signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23927065 2013 Actin stimulates reduction of the MICAL-2 monooxygenase domain.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22331357 2012 Differential regulation of actin microfilaments by human MICAL proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16675569 2006 Expression of novel molecules, MICAL2-PV (MICAL2 prostate cancer variants), increases with high Gleason score and prostate cancer progression.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15694364 2005 The MICAL proteins and rab1: a possible link to the cytoskeleton?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110185 2002 MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.