Property Summary

NCBI Gene PubMed Count 30
PubMed Score 37.85
PubTator Score 27.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.200 7.5e-08
oligodendroglioma 1.200 6.8e-03
osteosarcoma -2.868 1.3e-06
pancreatic ductal adenocarcinoma liver m... 1.689 1.3e-03
non-small cell lung cancer -1.315 1.3e-16
intraductal papillary-mucinous adenoma (... 1.500 3.8e-04
intraductal papillary-mucinous carcinoma... 1.700 9.6e-04
sonic hedgehog group medulloblastoma 2.700 7.8e-07
spina bifida 1.212 3.1e-02
Pick disease -1.100 9.2e-04
gastric carcinoma 1.200 2.9e-02
ovarian cancer 1.400 4.8e-04

Gene RIF (10)

PMID Text
25576923 Data suggest that Sema6A and Mical1 may represent new potential therapeutic targets in BRAFV600E melanoma.
23834433 The MICAL1 directly induce oxidation of actin molecules, leading to actin depolymerization. ROS production by MICAL1 also causes oxidation of collapsin response mediator protein-2 which subsequently undergoes phosphorylation.
22331357 although MICAL1 is auto-inhibited by its C-terminal coiled-coil region, MICAL2 remains constitutively active and affects stress fibers, suggesting differential but complementary roles for MICAL1 and MICAL2 in actin microfilament regulation
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21638339 Faint and scattered immunoreactivity for Mical-1 is observed in neurons of the neocortex of the temporal lobe epilepsy group, while strong immunoreactivity for Mical-1 is shown in control subjects.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17662518 The unfolding of MICAL-1 calpolnin homology (CH) domain was studied.
12788069 MICAL-1 isoforms with their multidomain structure are novel rab1 interacting proteins that function as scaffold proteins connecting different components in the cell.
11827972 a CasL interacting molecule that associates with vimentin

AA Sequence

MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSAKSLWTKLDKR      1 - 70
AGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGA     71 - 140
KKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVTFTGLQPPPRKGSGWRAQLQPNPPAQLANYE    141 - 210
FDVLISAAGGKFVPEGFKVREMRGKLAIGITANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGID    211 - 280
LENIVYYKDDTHYFVMTAKKQCLLRLGVLRQDWPDTNRLLGSANVVPEALQRFTRAAADFATHGKLGKLE    281 - 350
FAQDAHGQPDVSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV    351 - 420
KRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVRDLYDVLAKEP    421 - 490
VQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSEL    491 - 560
QGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSMAHSPGPVSQASPGTSS    561 - 630
AVLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALC    631 - 700
GEHLYVLERLCVNGHFFHRSCFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQTDHKAEGSDRGPESPEL    701 - 770
PTPSENSMPPGLSTPTASQEGAGPVPDPSQPTRRQIRLSSPERQRLSSLNLTPDPEMEPPPKPPRSCSAL    771 - 840
ARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPTWR    841 - 910
RTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDK    911 - 980
KNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRF    981 - 1050
QEERRLSELALGTGAQG                                                        1051 - 1067
//

Text Mined References (36)

PMID Year Title
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25007825 2014 The intracellular redox protein MICAL-1 regulates the development of hippocampal mossy fibre connections.
24440334 2014 Redox modification of nuclear actin by MICAL-2 regulates SRF signaling.
23834433 2014 MICAL-family proteins: Complex regulators of the actin cytoskeleton.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22331357 2012 Differential regulation of actin microfilaments by human MICAL proteins.
22116028 2011 Direct redox regulation of F-actin assembly and disassembly by Mical.
21864500 2011 Kinetic and spectroscopic characterization of the putative monooxygenase domain of human MICAL-1.
21800438 2011 Extracellular inhibitors, repellents, and semaphorin/plexin/MICAL-mediated actin filament disassembly.
21730291 2011 MICAL-1 is a negative regulator of MST-NDR kinase signaling and apoptosis.
21638339 2011 Expression pattern of Mical-1 in the temporal neocortex of patients with intractable temporal epilepsy and pilocarpine-induced rat model.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20148037 2010 Mical links semaphorins to F-actin disassembly.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18305261 2008 Release of MICAL autoinhibition by semaphorin-plexin signaling promotes interaction with collapsin response mediator protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17662518 2007 Investigation of the four cooperative unfolding units existing in the MICAL-1 CH domain.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043746 2006 Solution structure of calponin homology domain of Human MICAL-1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16275925 2005 High-resolution structure of the catalytic region of MICAL (molecule interacting with CasL), a multidomain flavoenzyme-signaling molecule.
16230022 2006 MICAL flavoprotein monooxygenases: expression during neural development and following spinal cord injuries in the rat.
15694364 2005 The MICAL proteins and rab1: a possible link to the cytoskeleton?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12788069 2003 MICAL-1 isoforms, novel rab1 interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110185 2002 MICALs, a family of conserved flavoprotein oxidoreductases, function in plexin-mediated axonal repulsion.
11827972 2002 MICAL, a novel CasL interacting molecule, associates with vimentin.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.