Property Summary

NCBI Gene PubMed Count 44
PubMed Score 99.49
PubTator Score 114.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (32)

PMID Text
24608986 data provide evidence for a critical role of SOX10 in melanoma cell invasion through the regulation of MIA and highlight its role as a therapeutic target in melanoma
24372647 Focus on the quantitative analysis of the MIA protein as a prognostic tool because it has proven to be a useful serum marker for documenting disease progression of malignant melanoma. Review.
24349210 The effects of MIA/CD-RAP on transcriptional regulation in chondrocytes, through the regulation of p54(nrb) via YBX1 contributes to the understanding of chondrogenesis.
23672612 Functional promoter analysis identified the transcription factor YBX1 as the mediator of MIA activation of p54(nrb) transcription.
23664187 MIA protein is present in non-segmental vitiligo skin and may cause the detachment of melanocytes; its target is integrin alpha5beta1, which determines the breaking and/or weakening of connections among melanocytes and basal membrane
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
21658116 assessed the utility of melanoma inhibitory activity (MIA) serum marker in the follow up and primary diagnosis of stage III melanoma patients
21540751 Further diagnostics should be initiated in uveal melanoma patients with serum MIA above 8.3ng/ml.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21277254 The cell-specific production rate of MIA was quantitatively proportional to the aggrecan gene expression level in the early and middle phase of cartilage chondrocyte differentiation.
20514540 pancreatic cancer patients with high intratumoral expression are antibody-negative and have shorter survival
20164682 MIA/CD-RAP stabilizes cartilage differentiation and inhibits differentiation into bone potentially by regulating signaling processes during differentiation.
20139419 The expression of melanoma inhibitory activity gene (MIA) is upregulated in both Jurkat-Tat101 and Jurkat-Tat72 cells
19852767 A fluorescence polarization biological assay was developed using MIA protein-binding compounds for studies of the binding properties of this protein.
19521988 MIA protein, binding to integrins and thus promoting detachment of cells from extracellular matrix structures, is internalized into the cell together with these cell adhesion receptors at the cell rear.
18616526 MIA expression is enhanced by the interaction of intracellular HMGB1 and NFkBp65 and MIA is closely involved in tumor progression and nodal metastasis by the increments of VEGF-C and VEGF-D in oral squamous cell carcinomas.
18477894 MIA serum level is the ideal test for screening the skin melanoma spread to sentinel lymph nodes.
18181974 Measurement of Melan-A, gp100, MAGE-3, MIA and tyrosinase represents a prognostic factor and a method for early detection of metastasis and treatment response of melanoma patients.
17661202 An antigen in melanoma, elevated in 22 per cent of patients, predicting recurrence.
17599744 A candidate autoantigen in rheumatoid arthritis found in synovial fluid cells.
17348447 When patients progressed, level of MIA increased significantly.
16331256 Increased levels of MIA is associated with gastric cancer
15760338 There is a correlation between MIA expression and pigmentation and morphology of melanocytic cells.
15547763 MIA in homogenates of surgical specimen directly relate to a more benign clinical prognosis in patients with high-grade glioma
15386421 MIA may contribute to immunosuppression frequently seen in malignant melanomas by inhibiting cellular antitumor immune reactions.
15208686 The MIA protein enhances the migration of melanocytes and promotes melanoma progression.
15201995 MIA may promote the detachment of radial and vertical growth phase melanomas.
15057037 increased MIA production may, in turn, increase the invasive properties of the cells by modulating the attachment of human uveal melanoma cells to the extracellular matrix
12665595 Stable antisense-HMG1 expression in melanoma cells led to the reduction of melanoma inhibitory activity (MIA) promoter activity and protein expression.
12230496 expression pattern of a novel splice product MIA (splice) of malignant melanoma-derived growth-inhibiting activity (MIAY CD-RAP).
12014625 Melanoma-inhibiting activity (MIA/CD-RAP) is expressed in a variety of malignant tumors of mainly neuroectodermal origin.
11991352 The assignments, solution structure, & dynamics of human MIA were determined by heteronuclear NMR methods. The structure consists of an SH3-like subdomain with N- and C-terminal extensions of about 20 amino acids each that form a novel fold.

AA Sequence

MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV      1 - 70
YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ              71 - 131
//

Text Mined References (45)

PMID Year Title
24608986 2014 SOX10 promotes melanoma cell invasion by regulating melanoma inhibitory activity.
24372647 2014 Melanoma inhibitory activity in melanoma diagnostics and therapy - a small protein is looming large.
24349210 2013 YBX1 is a modulator of MIA/CD-RAP-dependent chondrogenesis.
23672612 2013 Melanoma inhibitory activity promotes melanoma development through activation of YBX1.
23664187 2013 Role of alpha5beta1 integrin and MIA (melanoma inhibitory activity) in the pathogenesis of vitiligo.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
22081228 2011 Genome-wide association study identifies FCGR2A as a susceptibility locus for Kawasaki disease.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21658116 2011 Impact of lymph node metastases on serum level of melanoma inhibitory activity in stage III melanoma patients.
21540751 2011 Receiver operating characteristic analysis: calculation for the marker 'melanoma inhibitory activity' in metastatic uveal melanoma patients.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21277254 2011 Quantitative correlation between production rate of melanoma inhibitory activity and aggrecan gene expression level during differentiation from mesenchymal stem cells to chondrocytes and redifferentiation of chondrocytes.
20514540 2010 Immunogenicity of SEREX-identified antigens and disease outcome in pancreatic cancer.
20164682 2010 Modulation of cartilage differentiation by melanoma inhibiting activity/cartilage-derived retinoic acid-sensitive protein (MIA/CD-RAP).
19852767 2009 Heterogeneous transition metal-based fluorescence polarization (HTFP) assay for probing protein interactions.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19521988 2009 Processing of MIA protein during melanoma cell migration.
18616526 2008 High mobility group box-1-inducible melanoma inhibitory activity is associated with nodal metastasis and lymphangiogenesis in oral squamous cell carcinoma.
18494554 2008 A novel tumor-promoting function residing in the 5' non-coding region of vascular endothelial growth factor mRNA.
18477894 2008 Biological value of melanoma inhibitory activity serum concentration in patients with primary skin melanoma.
18181974 2008 Multimarker real-time reverse transcription-PCR for quantitative detection of melanoma-associated antigens: a novel possible staging method.
17661202 2007 A Comparison of 3 tumor markers (MIA, TA90IC, S100B) in stage III melanoma patients.
17599744 2007 Endogenous HLA-DR-restricted presentation of the cartilage antigens human cartilage gp-39 and melanoma inhibitory activity in the inflamed rheumatoid joint.
17348447 Melanoma inhibiting activity protein (MIA), beta-2 microglobulin and lactate dehydrogenase (LDH) in metastatic melanoma.
16341674 2005 Transcriptome analysis of human gastric cancer.
16331256 2006 Systematic search for gastric cancer-specific genes based on SAGE data: melanoma inhibitory activity and matrix metalloproteinase-10 are novel prognostic factors in patients with gastric cancer.
15760338 2005 Inhibition of melanoma inhibitory activity (MIA) expression in melanoma cells leads to molecular and phenotypic changes.
15547763 2004 Expression levels of melanoma inhibitory activity correlate with time to progression in patients with high-grade glioma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386421 2005 Inhibition of immunosuppressive effects of melanoma-inhibiting activity (MIA) by antisense techniques.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15208686 2004 Functional role of MIA in melanocytes and early development of melanoma.
15201995 2004 Ultraviolet radiation induces release of MIA: a new mechanism for UVR-induced progression of melanoma.
15057037 2004 Macrophage-derived soluble factor enhances melanoma inhibitory activity expression by uveal melanoma cells in vitro.
12665595 2003 Upregulation of HMG1 leads to melanoma inhibitory activity expression in malignant melanoma cells and contributes to their malignancy phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230496 2002 Cloning and characterization of the expression pattern of a novel splice product MIA (splice) of malignant melanoma-derived growth-inhibiting activity (MIA/CD-RAP) [corrected].
11991352 2002 Solution structure and dynamics of melanoma inhibitory activity protein.
11331761 2001 Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.
11157741 2001 The extracellular human melanoma inhibitory activity (MIA) protein adopts an SH3 domain-like fold.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8661134 1996 Assignment of the human melanoma inhibitory activity gene (MIA) to 19q13.32-q13.33 by fluorescence in situ hybridization (FISH).
8550608 1996 Structure and promoter analysis of the gene encoding the human melanoma-inhibiting protein MIA.
7923218 1994 Cloning of a novel malignant melanoma-derived growth-regulatory protein, MIA.