Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.60
PubTator Score 11.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 1.7e-07
astrocytic glioma -1.400 1.3e-02
oligodendroglioma -1.100 4.7e-02
psoriasis -1.900 2.2e-05
osteosarcoma -1.142 1.0e-02
tuberculosis 1.200 6.8e-08
lung cancer 1.200 6.9e-03
non primary Sjogren syndrome sicca 1.400 3.4e-02
ovarian cancer -1.200 8.5e-05
Breast cancer 1.100 8.7e-06

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (5)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of microsomal glutathione S-transferase 3 (MGST3) expression by HIV-1 Vpr in Vpr transduced macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPP      1 - 70
FLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWV     71 - 140
KSGLGSGPKCCH                                                              141 - 152
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21044946 2011 Site-specific analysis of protein S-acylation by resin-assisted capture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17719568 2007 Subtractive hybridisation screen identifies genes regulated by glucose deprivation in human neuroblastoma cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12898215 2003 Evaluation of the microsomal glutathione S-transferase 3 (MGST3) locus on 1q23 as a Type 2 diabetes susceptibility gene in Pima Indians.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673221 2000 Membrane-associated proteins in eicosanoid and glutathione metabolism (MAPEG). A widespread protein superfamily.
9278457 1997 Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.