Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.28
PubTator Score 13.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (2)

Gene RIF (7)

PMID Text
26066610 Trimeric microsomal protein MGST2 displays one third of the sites reactivity.
23409838 characterized the substrate specificity and catalytic properties of purified MGST2 by steady-state and pre-steady-state kinetic experiments
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
16773312 Observational study of gene-disease association. (HuGE Navigator)
16773312 A large Chinese sample of psoriasis did not provide any supporting evidence for MGST2 to be the psoriasis susceptibility gene within the PSORS9 locus.
16498398 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMA      1 - 70
GWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIA     71 - 140
KKLRRQF                                                                   141 - 147
//

Text Mined References (20)

PMID Year Title
26066610 2015 Trimeric microsomal glutathione transferase 2 displays one third of the sites reactivity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23409838 2013 Catalytic characterization of human microsomal glutathione S-transferase 2: identification of rate-limiting steps.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16773312 2006 Systematic evaluation of association between the microsomal glutathione S-transferase 2 common variation and psoriasis vulgaris in Chinese population.
16498398 2006 A novel MGST2 non-synonymous mutation in a Chinese pedigree with psoriasis vulgaris.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11322876 2001 Human umbilical vein endothelial cells generate leukotriene C4 via microsomal glutathione S-transferase type 2 and express the CysLT(1) receptor.
10673221 2000 Membrane-associated proteins in eicosanoid and glutathione metabolism (MAPEG). A widespread protein superfamily.
9302651 1997 Characterization of microsomal GST-II by western blot and identification of a novel LTC4 isomer.
9278457 1997 Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.
9092565 1997 Production of leukotriene C4 in different human tissues is attributable to distinct membrane bound biosynthetic enzymes.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8703034 1996 Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.