Property Summary

NCBI Gene PubMed Count 30
PubMed Score 183.58
PubTator Score 66.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
24486338 possibly marked variations in NB mitochondrial homeostasis, they also imply that the results of these earlier studies using NB cells are not transferable to other tumor and cell types that express MGST1 at high concentrations.
23805041 Differential expression of SOD2, ALDH1A1, and MGST1 genes in the anterior lens capsules of patients with pseudoexfoliation syndrome suggest that diseased tissue appears to respond to the previously reported oxidative stress.
23314968 The results suggest that MGST1 gene polymorphisms as one of environment gene may contribute to colorectal cancer risk in younger ages.
20727966 MGST1 protects cells (and mitochondria) by both conjugation and glutathione peroxidase functions. A new protective mechanism against cisplatin is also indicated
19343046 Observational study of gene-disease association. (HuGE Navigator)
17714764 Genes encoding KU70, MGST1 and BIK show age-related mRNA expression levels in hematopoietic stem cells.
17483957 Observational study of gene-disease association. (HuGE Navigator)
16384981 Observational study of gene-disease association. (HuGE Navigator)
15338373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12818425 The results indicate that Sp1 is the protein mediating the basal transcription of MGST1
12359356 Polymorphisms in microsomal glutathione s transferase is associated with laryngeal cancer
11587073 As an addition to the high-density SNP (single-nucleotide polymorphism) maps of 12 glutathione S-transferase and related genes reported earlier, a SNP map of the microsomal glutathione S-transferase 1 (MGST1) gene is provided.

AA Sequence

MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVE      1 - 70
RVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGV     71 - 140
TLSMAYRLLKSKLYL                                                           141 - 155
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24486338 2014 Absence of MGST1 mRNA and protein expression in human neuroblastoma cell lines and primary tissue.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23805041 2013 Quantitative analysis of SOD2, ALDH1A1 and MGST1 messenger ribonucleic acid in anterior lens epithelium of patients with pseudoexfoliation syndrome.
23314968 2012 The role of xenobotic metabolism MGST1 gene polymorphism in colorectal cancer patients.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21269460 2011 Initial characterization of the human central proteome.
20727966 2010 Multiple roles of microsomal glutathione transferase 1 in cellular protection: a mechanistic study.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
17714764 2007 Age-related transcription levels of KU70, MGST1 and BIK in CD34+ hematopoietic stem and progenitor cells.
17483957 2007 Microsomal glutathione S-transferase gene polymorphisms and colorectal cancer risk in a Han Chinese population.
16541075 2006 The finished DNA sequence of human chromosome 12.
16384981 2006 Functional candidate genes in age-related macular degeneration: significant association with VEGF, VLDLR, and LRP6.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338373 2004 Genetic analysis of the glutathione s-transferase genes MGST1, GSTM3, GSTT1, and GSTM1 in patients with hereditary pancreatitis.
14726533 2004 Observation of an intact noncovalent homotrimer of detergent-solubilized rat microsomal glutathione transferase-1 by electrospray mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12818425 2003 Basal expression of the human MAPEG members microsomal glutathione transferase 1 and prostaglandin E synthase genes is mediated by Sp1 and Sp3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11587073 2001 Catalog of 46 single-nucleotide polymorphisms (SNPs) in the microsomal glutathione S-transferase 1 (MGST1) gene.
11034337 2000 Colocalization of leukotriene C synthase and microsomal glutathione S-transferase elucidated by indirect immunofluorescence analysis.
10777602 2000 Structural organization of the microsomal glutathione S-transferase gene (MGST1) on chromosome 12p13.1-13.2. Identification of the correct promoter region and demonstration of transcriptional regulation in response to oxidative stress.
10673221 2000 Membrane-associated proteins in eicosanoid and glutathione metabolism (MAPEG). A widespread protein superfamily.
10524215 1999 Microsomal GST-I: genomic organization, expression, and alternative splicing of the human gene.
10095775 1999 Distribution of microsomal glutathione transferase 1 in mammalian tissues. A predominant alternate first exon in human tissues.
8812420 1996 Structural organization of the human microsomal glutathione S-transferase gene (GST12).
7663172 1995 Protein-protein interaction affinity chromatography of leukotriene C4 synthase.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
3372534 1988 Gene expression of rat and human microsomal glutathione S-transferases.
2307478 1990 The gene for the microsomal glutathione S-transferase is on human chromosome 12.
1544849 1992 What role do glutathione S-transferases play in the cellular response to ionizing radiation?