| Tbio | Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B |
Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.
The MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).[supplied by OMIM, Nov 2008]
The MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).[supplied by OMIM, Nov 2008]
Comments
| Disease | Target Count |
|---|---|
| Polycystic Ovary Syndrome | 334 |
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 2.2e-12 |
| posterior fossa group A ependymoma | 1511 | 1.1e-07 |
| pilocytic astrocytoma | 3086 | 1.4e-06 |
| atypical teratoid / rhabdoid tumor | 4369 | 6.2e-06 |
| adult high grade glioma | 2148 | 6.6e-06 |
| glioblastoma | 5572 | 3.8e-05 |
| medulloblastoma, large-cell | 6234 | 1.5e-04 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Fukuyama congenital muscular dystrophy | 6 | 3.528 | 1.8 |
| Walker-Warburg syndrome | 18 | 3.022 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| posterior fossa group A ependymoma | -1.300 | 1.1e-07 |
| glioblastoma | -1.700 | 3.8e-05 |
| atypical teratoid / rhabdoid tumor | -1.500 | 6.2e-06 |
| medulloblastoma, large-cell | -1.800 | 1.5e-04 |
| adult high grade glioma | -1.900 | 6.6e-06 |
| pilocytic astrocytoma | -1.700 | 1.4e-06 |
| ovarian cancer | 1.400 | 2.2e-12 |
| PMID | Text | |
|---|---|---|
| 23960081 | ENPP3 is a regulator of N-acetylglucosaminyltransferase GnT-IX (GnT-Vb) | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19846580 | The activity of GnT-Vb was stimulated over 4-fold in the presence of 10 mM Mn(++), and pH optimum for GnT-Vb was 8.0. | |
| 18838383 | GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface. | |
| 16857188 | GnT-Vb enzyme involved in the O-mannosyl glycosylation pathway, play an active role in modulating integrin and laminin-dependent adhesion and migration of human neuronal cells. | |
| 16606368 | These results demonstrate that GnT-VB expression can modulate the rate of neurite outgrowth by affecting beta1 integrin-ECM interaction. | |
| 16413118 | following human GnT-IX and GnT-V transfection in COS cells, antibody specifically recognized GnT-IX, but not GnT-V, in the Golgi apparatus | |
| 14561752 | N-linked beta(1,6) branching has a role in cell-cell adhesion, cellular motility and neoplasm invasiveness | |
| 12941944 | GnT-IX is responsible for the synthesis of a unique oligosaccharide structure in the brain | |
| 11530211 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 9109416 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 8673525 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 8093218 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 3264072 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 3099781 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 2829950 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 2649653 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 2541446 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 2187500 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions | |
| 1736542 | Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions |
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGV 1 - 70 LRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILR 71 - 140 HSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPP 141 - 210 LPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQ 211 - 280 RDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGR 281 - 350 GSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWN 351 - 420 LNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYME 421 - 490 IHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPP 491 - 560 HSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEFEAAIKAIMRTQVDPYLPYEYTCEGM 561 - 630 LERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRAC 631 - 700 TDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTK 701 - 770 YRRLCPCRDFRKGQVALCQGCL 771 - 792 //
| PMID | Year | Title | |
|---|---|---|---|
| 24383474 | 2014 | Genome-wide study of percent emphysema on computed tomography in the general population. The Multi-Ethnic Study of Atherosclerosis Lung/SNP Health Association Resource Study. | |
| 23960081 | 2013 | Identification of ectonucleotide pyrophosphatase/phosphodiesterase 3 (ENPP3) as a regulator of N-acetylglucosaminyltransferase GnT-IX (GnT-Vb). | |
| 23088713 | 2012 | Protein interactions of the transcription factor Hoxa1. | |
| 22823124 | 2013 | The genetic aetiology of cannabis use initiation: a meta-analysis of genome-wide association studies and a SNP-based heritability estimation. | |
| 22683750 | 2012 | A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19846580 | 2010 | Comparison of the substrate specificities and catalytic properties of the sister N-acetylglucosaminyltransferases, GnT-V and GnT-Vb (IX). | |
| 18838383 | 2008 | Receptor tyrosine phosphatase beta (RPTPbeta) activity and signaling are attenuated by glycosylation and subsequent cell surface galectin-1 binding. | |
| 16857188 | 2006 | Integrin-dependent neuroblastoma cell adhesion and migration on laminin is regulated by expression levels of two enzymes in the O-mannosyl-linked glycosylation pathway, PomGnT1 and GnT-Vb. | |
| 16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. | |
| 16606368 | 2006 | N-acetylglucosaminyltranferase VB expression enhances beta1 integrin- dependent PC12 neurite outgrowth on laminin and collagen. | |
| 16413118 | 2006 | Demonstration of the expression and the enzymatic activity of N-acetylglucosaminyltransferase IX in the mouse brain. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 14623122 | 2003 | A novel beta(1,6)-N-acetylglucosaminyltransferase V (GnT-VB)(1). | |
| 14617637 | 2004 | N-Acetylglucosaminyltransferase IX acts on the GlcNAc beta 1,2-Man alpha 1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. | |
| 14561752 | 2003 | N-acetylglucosaminyltransferase V expression levels regulate cadherin-associated homotypic cell-cell adhesion and intracellular signaling pathways. | |
| 12941944 | 2003 | Molecular cloning and characterization of human GnT-IX, a novel beta1,6-N-acetylglucosaminyltransferase that is specifically expressed in the brain. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
