Property Summary

NCBI Gene PubMed Count 29
PubMed Score 69.93
PubTator Score 73.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 8.7e-06
psoriasis 6685 2.1e-04
osteosarcoma 7933 3.6e-03
non primary Sjogren syndrome sicca 840 4.0e-02
spina bifida 1064 4.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.100 2.1e-04
osteosarcoma -1.058 3.6e-03
non primary Sjogren syndrome sicca 1.100 4.0e-02
spina bifida 1.041 4.5e-02
ovarian cancer 1.700 8.7e-06

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (12)

PMID Text
26371870 The authors show here that the luminal domain of GnT1IP-L contains its MGAT1 inhibitory activity.
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24572742 The IL2RA and IL7RA variants had univariate association in MS and T1D, whereas the MGAT1 and CTLA-4 variants associated with only MS or T1D, respectively.
22957033 analysis of suppression of cancer progression by MGAT1 shRNA knockdown
21304485 Genetic variants downstream MGAT1 seem to influence susceptibility to obesity. Moreover, these genetic variants affect the levels of serum unsaturated fatty acids and Delta desaturase indices, variables previously shown to correlate with obesity.
20335257 HIV-1 Env trimers expressing in the absence of GNTI have a mass of 394-390 kDa compared to the parent trimers of about 420 kDa. HIV-1 produced in the absence of GNTI is infectious
19851299 The analysis enabled us to identify a new candidate gene, MGAT1, associated with weight in women.
19851299 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19826906 Activity of HuGnTI in plants is limited by a combination of reduced protein stability, alternative protein targeting and possibly to some extend to lower enzymatic performance of the catalytic domain in the plant biochemical environment.
19219857 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (MGAT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17716624 Findings indicated that cysteine 121 has a structural role in maintaining active site geometry of hGnT1, rather than a catalytic role, and illustrates for the first time the potential utility of E. coli as an expression system for hGnT1.

AA Sequence

MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQDAEVELERQRG      1 - 70
LLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVS     71 - 140
QDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVED    141 - 210
DLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELE    211 - 280
PKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQ    281 - 350
REAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV    351 - 420
TFQFRGRRVHLAPPLTWEGYDPSWN                                                 421 - 445
//

Text Mined References (31)

PMID Year Title
26371870 2015 GnT1IP-L specifically inhibits MGAT1 in the Golgi via its luminal domain.
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24572742 2014 Family studies of type 1 diabetes reveal additive and epistatic effects between MGAT1 and three other polymorphisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22957033 2012 Suppression of cancer progression by MGAT1 shRNA knockdown.
21304485 2012 Genetic variants near the MGAT1 gene are associated with body weight, BMI and fatty acid metabolism among adults and children.
19946888 2010 Defining the membrane proteome of NK cells.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.
19826906 2010 Differential effects of human and plant N-acetylglucosaminyltransferase I (GnTI) in plants.
19219857 2009 Genetic association studies of methamphetamine use disorders: A systematic review and synthesis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
17716624 2007 Refolding of human beta-1-2 GlcNAc transferase (GnT1) and the role of its unpaired Cys 121.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077311 2002 Identification of a gene encoding MGAT1, a monoacylglycerol acyltransferase.
9020882 1997 Organization of the human beta-1,2-N-acetylglucosaminyltransferase I gene (MGAT1), which controls complex and hybrid N-glycan synthesis.
7635144 1995 The human UDP-N-acetylglucosamine: alpha-6-D-mannoside-beta-1,2- N-acetylglucosaminyltransferase II gene (MGAT2). Cloning of genomic DNA, localization to chromosome 14q21, expression in insect cells and purification of the recombinant protein.
1827260 1991 Organization and localization to chromosome 5 of the human UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I gene.
1702225 1990 Cloning and expression of N-acetylglucosaminyltransferase I, the medial Golgi transferase that initiates complex N-linked carbohydrate formation.
1421759 1992 Cloning and expression of the murine gene and chromosomal location of the human gene encoding N-acetylglucosaminyltransferase I.