Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.75
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.7e-03
glioblastoma -1.100 1.9e-03
intraductal papillary-mucinous adenoma (... 1.300 4.4e-03
intraductal papillary-mucinous carcinoma... 1.100 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-02
lung cancer 1.200 5.9e-03
osteosarcoma -1.725 4.6e-04
psoriasis -1.600 4.8e-04

Gene RIF (1)

AA Sequence

MELGGHWDMNSAPRLVSETAERKQEQKTGTEAEAADSGAVGARRFLLCLYLVGFLDLFGVSMVVPLLSLH      1 - 70
VKSLGASPTVAGIVGSSYGILQLFSSTLVGCWSDVVGRRSSLLACILLSALGYLLLGAATNVFLFVLARV     71 - 140
PAGIFKHTLSISRALLSDVVPEKERPLVIGHFNTASGVGFILGPVVGGYLTELEDGFYLTAFICFLVFIL    141 - 210
NAGLVWFFPWREAKPGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNL    211 - 280
LFSEMWDIFLVRLLMAMAVMLYYSNFVLALEERFGVRPKVTGYLISYSSMLGAVAGLALGPILRLYKHNS    281 - 350
QALLLHSSILTCTLLLLYSLAPTMGAVVLSSTLLSFSTAIGRTCITDLQLTVGGAQASGTLIGVGQSVTA    351 - 420
VGRIIAPLLSGVAQEVSPCGPPSLGAVLALVAIFIMSLNKRHSSGDGNSKLKSE                    421 - 474
//

Text Mined References (11)

PMID Year Title