Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.06
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 1.8
Disease Target Count Z-score Confidence
Fanconi syndrome 14 3.38 1.7
Gingival Overgrowth 33 3.089 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.129 8.2e-07
ovarian cancer -1.400 7.4e-05
pancreatic ductal adenocarcinoma liver m... -1.182 1.2e-02
Rheumatoid arthritis 1.100 1.3e-02

AA Sequence

MTQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHT      1 - 70
FLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTF     71 - 140
SVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVP    141 - 210
ESLPEKMRPASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPE    211 - 280
SVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSIT    281 - 350
FPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPITGTDLGTNTSPQHHF    351 - 420
EQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHNTQAPGEAKEPLLQDTNV    421 - 490
//

Text Mined References (7)

PMID Year Title