Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.28
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.538 1.1e-02
Multiple myeloma 1.561 8.9e-04
glioblastoma 2.600 4.0e-05
astrocytoma 1.800 1.8e-02
Duchenne muscular dystrophy 1.297 4.7e-07
juvenile dermatomyositis 1.427 5.6e-10
acute quadriplegic myopathy 1.167 2.5e-05
pilocytic astrocytoma 1.400 3.9e-09
invasive ductal carcinoma 1.091 3.2e-04
ovarian cancer 2.900 4.4e-06
dermatomyositis 1.500 4.9e-03

Gene RIF (1)

PMID Text
21752829 MFSD1 protein localizes in lysosomes in HeLa cells

AA Sequence

MEEEDEEARALLAGGPDEADRGAPAAPGALPALCDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQV      1 - 70
KRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLME     71 - 140
FGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTT    141 - 210
LGITLMIGGITCILSLICALALAYLDQRAERILHKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAV    211 - 280
FPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAF    281 - 350
TMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFL    351 - 420
EVFFIACVSLSLLSVVLLYLVNRAQGGNLNYSARQREEIKFSHTE                             421 - 465
//

Text Mined References (6)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.