Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.88
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.600 7.3e-03
osteosarcoma -2.928 1.9e-05
glioblastoma 1.500 4.9e-05
sonic hedgehog group medulloblastoma 2.700 1.4e-05
medulloblastoma, large-cell 1.900 2.1e-02
non-small cell lung cancer -2.056 1.5e-26
interstitial cystitis 1.600 3.8e-03
adult high grade glioma 1.700 3.8e-04
pilocytic astrocytoma 1.300 2.4e-06
primary Sjogren syndrome 1.100 4.9e-03
subependymal giant cell astrocytoma 1.047 1.4e-02
lung adenocarcinoma -1.800 1.9e-13
lung carcinoma -1.600 5.5e-23
spina bifida 1.111 4.1e-02
ulcerative colitis 1.200 1.5e-03

Gene RIF (3)

PMID Text
25808869 Mfng is an oncogene acting through Notch-mediated induction of Pik3cg.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15280477 down regulated in Papillomavirus-mediated cervical neoplasia.

AA Sequence

MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLR      1 - 70
LELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCH     71 - 140
VDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALK    141 - 210
MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFE    211 - 280
GKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR                                 281 - 321
//

Text Mined References (19)

PMID Year Title
25808869 2015 Manic fringe promotes a claudin-low breast cancer phenotype through notch-mediated PIK3CG induction.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15280477 2004 Papillomavirus-mediated neoplastic progression is associated with reciprocal changes in JAGGED1 and manic fringe expression linked to notch activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486116 2003 Fringe modifies O-fucose on mouse Notch1 at epidermal growth factor-like repeats within the ligand-binding site and the Abruptex region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
11978185 2002 Notch signalling is linked to epidermal cell differentiation level in basal cell carcinoma, psoriasis and wound healing.
11346656 2001 Manic fringe and lunatic fringe modify different sites of the Notch2 extracellular region, resulting in different signaling modulation.
10935626 2000 Fringe is a glycosyltransferase that modifies Notch.
10640833 1999 Assignment of human MFNG, manic fringe Drosophila homolog, to 22q13.1 using tyramide fluorescence in situ hybridization (T-FISH).
10591208 1999 The DNA sequence of human chromosome 22.
10341080 1999 Genomic structure, mapping, and expression analysis of the mammalian Lunatic, Manic, and Radical fringe genes.
9878264 1998 Mapping of the human Lunatic Fringe (LFNG) gene to 7p22 and Manic Fringe (MFNG) to 22q12.
9207795 1997 Fringe boundaries coincide with Notch-dependent patterning centres in mammals and alter Notch-dependent development in Drosophila.
9187150 1997 A family of mammalian Fringe genes implicated in boundary determination and the Notch pathway.