Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.60
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.600 9.0e-03
hepatocellular carcinoma 1.400 3.3e-03
pancreatic cancer 1.900 3.7e-03
Waldenstrons macroglobulinemia -1.039 2.6e-02
malignant mesothelioma 1.800 1.2e-06
psoriasis -2.100 5.8e-05
osteosarcoma -2.051 8.8e-05
sonic hedgehog group medulloblastoma -4.300 2.7e-07
atypical teratoid/rhabdoid tumor -2.100 3.6e-05
medulloblastoma, large-cell -4.100 5.1e-06
primitive neuroectodermal tumor -2.900 2.4e-03
pancreatic ductal adenocarcinoma liver m... -2.033 1.0e-02
non-small cell lung cancer -1.481 5.1e-11
lung cancer -2.100 7.9e-05
interstitial cystitis -4.100 4.8e-06
lung adenocarcinoma -1.270 8.2e-07
pancreatic carcinoma 1.900 3.7e-03
Breast cancer -1.700 1.9e-04
ovarian cancer 2.000 1.7e-03
pituitary cancer -3.000 3.9e-05
Down syndrome 1.100 4.6e-03

Gene RIF (1)

PMID Text
24735981 MFAP3L activation promotes colorectal cancer cell invasion and metastasis.

AA Sequence

MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSV      1 - 70
YGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTL     71 - 140
RVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLKKTEKAINEFFRTEGAEKLQKAFEIAKRIPI    141 - 210
ITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEA    211 - 280
ADRDEVYTIPNSLKRSDSPAADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSA    281 - 350
EHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESHV               351 - 409
//

Text Mined References (7)

PMID Year Title
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
24735981 2014 MFAP3L activation promotes colorectal cancer cell invasion and metastasis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.