Property Summary

NCBI Gene PubMed Count 29
PubMed Score 68.43
PubTator Score 35.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer 1.600 4.5e-03

Protein-protein Interaction (3)

Gene RIF (8)

PMID Text
23201136 Our characterization of alternative forms of MAGP2 present in the extracellular space not only enhances diversity of this ECM protein but also provides a previously unrecognized molecular mechanism for regulation of MAGP2 biological activity.
22885067 Decreased MFAP2 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that microfibrillar-associated protein 2 (MFAP2) is a Nef-binding protein in Jurkat cells
21540769 Demonstrate specific immunolocalization of fibrillin-1, MAGP-1, and LTBP-1 with elastin in the outer annulus fibrosus of the fetal human intravertebral disc.
19182256 Observational study of gene-disease association. (HuGE Navigator)
17692555 Study suggests a dual role for MAGP1, with extracellular MAGP1A involved in ECM function, and intracellular MAGP1B modulating the expression of genes that function in cell adhesion, migration and control of ECM deposition.
16492672 microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway
15233806 These results demonstrate that microfibril-associated glycoprotein-1 is capable of cumulative binding to distinct regions on tropoelastin, with different apparent dissociation constants and different amounts of bound protein.

AA Sequence

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV      1 - 70
QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT     71 - 140
VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC                               141 - 183
//

Text Mined References (30)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25406291 2014 Human eye development is characterized by coordinated expression of fibrillin isoforms.
24353434 2013 Investigation of age-related decline of microfibril-associated glycoprotein-1 in human skin through immunohistochemistry study.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23201136 2013 Identification of a functional proprotein convertase cleavage site in microfibril-associated glycoprotein 2.
22885067 2012 NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21540769 2011 Comparative immunolocalization of the elastin fiber-associated proteins fibrillin-1, LTBP-2, and MAGP-1 with components of the collagenous and proteoglycan matrix of the fetal human intervertebral disc.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19182256 2009 Exploring functional candidate genes for genetic association in german patients with pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
17692555 2007 The intracellular form of human MAGP1 elicits a complex and specific transcriptional response.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16492672 2006 Microfibrillar proteins MAGP-1 and MAGP-2 induce Notch1 extracellular domain dissociation and receptor activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15233806 2004 Microfibril-associated glycoprotein-1 binding to tropoelastin: multiple binding sites and the role of divalent cations.
15044481 2004 Identification of a major microfibril-associated glycoprotein-1-binding domain in fibrillin-2.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11796718 2002 Identification of a matrix-binding domain in MAGP1 and MAGP2 and intracellular localization of alternative splice forms.
11723132 2002 Molecular interactions of biglycan and decorin with elastic fiber components: biglycan forms a ternary complex with tropoelastin and microfibril-associated glycoprotein 1.
11481325 2001 Protein interaction studies of MAGP-1 with tropoelastin and fibrillin-1.
11284693 2001 Posttranslational modifications of microfibril associated glycoprotein-1 (MAGP-1).
11102756 2000 Revised genomic structure of the human MAGP1 gene and identification of alternate transcripts in human and mouse tissues.
10664011 2000 Expression of microfibril-associated glycoprotein-1 (MAGP-1) in human epidermal keratinocytes.
9278443 1997 Microfibril-associated glycoprotein-1 (MAGP-1) binds to the pepsin-resistant domain of the alpha3(VI) chain of type VI collagen.
8761465 1996 Functional domains on elastin and microfibril-associated glycoprotein involved in elastic fibre assembly.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7759096 1995 Characterization of the human gene for microfibril-associated glycoprotein (MFAP2), assignment to chromosome 1p36.1-p35, and linkage to D1S170.
3015971 1986 The major antigen of elastin-associated microfibrils is a 31-kDa glycoprotein.