Property Summary

NCBI Gene PubMed Count 29
PubMed Score 72.85
PubTator Score 35.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Cysts 41 0.0 0.0
Disease Target Count P-value
inflammatory breast cancer 286 4.5e-03
Disease Target Count Z-score Confidence
tuberculosis 2010 3.487 1.7
Pseudoxanthoma elasticum 18 3.023 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer 1.600 4.5e-03

Gene RIF (8)

AA Sequence

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV      1 - 70
QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT     71 - 140
VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC                               141 - 183
//

Text Mined References (30)

PMID Year Title