Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.42
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma 1524 3.5e-05
glioblastoma 5572 4.2e-05
osteosarcoma 7933 1.4e-04
lung cancer 4473 3.5e-04
ovarian cancer 8491 3.8e-04
adult high grade glioma 2148 3.8e-03

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.025 1.4e-04
glioblastoma -1.500 4.2e-05
medulloblastoma -1.200 3.5e-05
lung cancer 1.300 3.5e-04
adult high grade glioma -1.200 3.8e-03
ovarian cancer -1.500 3.8e-04

Synonym

Accession Q9H1A3 Q8NBT8 Q9BWJ7 Q9H1A2 Q9Y390
Symbols DREV
PAP1
DREV1
CGI-81

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
16837177 cloned the PAP1 gene, a p53 activated protein, from a U251-pTet-p53 cell line which carried a wild-type p53 transgene.

AA Sequence

MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQA      1 - 70
VFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKI     71 - 140
NPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLN    141 - 210
LLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVF    211 - 280
RKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV                                    281 - 318
//

Text Mined References (13)

PMID Year Title
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16837177 2006 Characterization of the human PAP1 gene and its homologue possible involvement in mouse embryonic development.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16413759 2006 Effects of exogenous p53 transfection on the gene expression in the human brain glioma cell line U251.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11132146 2000 The mouse and human IGSF6 (DORA) genes map to the inflammatory bowel disease 1 locus and are embedded in an intron of a gene of unknown function.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.