Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.10
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Multiple myeloma 1.009 3.5e-02
malignant mesothelioma -3.000 1.0e-08
oligodendroglioma 1.200 6.9e-03
osteosarcoma -2.507 1.4e-03
group 4 medulloblastoma -2.800 2.3e-08
astrocytoma 1.400 1.9e-02
atypical teratoid/rhabdoid tumor -2.900 2.0e-07
medulloblastoma, large-cell -3.500 4.6e-06
tuberculosis 1.800 2.4e-05
non-small cell lung cancer -1.639 2.4e-16
intraductal papillary-mucinous carcinoma... -1.600 6.9e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.7e-02
colon cancer -3.200 1.1e-03
lung cancer -5.500 2.1e-07
ulcerative colitis -1.900 3.2e-06
pancreatic cancer -1.100 1.8e-05
breast carcinoma -1.300 1.8e-04
cystic fibrosis -1.200 8.4e-04
lung adenocarcinoma -2.700 1.0e-11
non-inflammatory breast cancer -1.800 3.0e-03
Polycystic Ovary Syndrome 1.402 3.5e-02
Pick disease 1.700 7.3e-06
ductal carcinoma in situ -1.400 7.4e-04
invasive ductal carcinoma -1.800 5.6e-04
ovarian cancer -4.000 2.9e-12
Gaucher disease type 3 -1.700 2.8e-02
pituitary cancer -3.000 2.8e-05
Down syndrome 1.200 1.1e-02
chronic rhinosinusitis -1.334 1.2e-02

Gene RIF (1)

PMID Text
26185986 AAM-B is predominantly localized in lipid droplets and may be involved in recruitment of NS4B protein in the proximity of lipid droplets.

AA Sequence

MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG      1 - 70
KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV     71 - 140
VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK    141 - 210
ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK                                        211 - 244
//

Text Mined References (13)

PMID Year Title
26185986 2015 AAM-B Interacts with Nonstructural 4B and Regulates Hepatitis C Virus Propagation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19773358 2009 Targeting sequences of UBXD8 and AAM-B reveal that the ER has a direct role in the emergence and regression of lipid droplets.
18477614 2008 Identification of a novel N-terminal hydrophobic sequence that targets proteins to lipid droplets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.