Property Summary

NCBI Gene PubMed Count 22
PubMed Score 38.58
PubTator Score 23.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.581 1.6e-03
malignant mesothelioma -1.700 2.2e-07
astrocytic glioma 1.500 4.7e-03
ependymoma 1.600 8.6e-04
oligodendroglioma 1.400 2.5e-03
psoriasis -1.200 1.4e-03
osteosarcoma -1.728 1.9e-06
group 3 medulloblastoma 1.600 1.1e-02
atypical teratoid / rhabdoid tumor 1.300 3.4e-04
primitive neuroectodermal tumor 1.100 9.2e-04
intraductal papillary-mucinous adenoma (... 1.100 2.2e-02
intraductal papillary-mucinous carcinoma... 1.200 3.8e-02
Pick disease -1.600 5.6e-06
progressive supranuclear palsy -1.100 1.0e-02
ovarian cancer 2.700 1.1e-05
dermatomyositis 1.200 7.9e-04

Gene RIF (3)

PMID Text
27281194 Structure of the METTL3-METTL14 complex
25456834 genetic inactivation impaired embryonic stem cells differentiation
24209618 Study identifies m(6)A methylation sites on many clock gene transcripts and shows that specific inhibition of m(6)A methylation by silencing of the m(6)A methylase Mettl3 is sufficient to elicit circadian period elongation and RNA processing delay.

AA Sequence

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVP      1 - 70
ELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDA     71 - 140
HPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPA    141 - 210
KKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGT    211 - 280
KEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS    281 - 350
QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP    351 - 420
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGN    421 - 490
PQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPD    491 - 560
VVARFKQRYPDGIISKPKNL                                                      561 - 580
//

Text Mined References (31)

PMID Year Title
27373337 2016 Structural Basis for Cooperative Function of Mettl3 and Mettl14 Methyltransferases.
27281194 2016 Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex.
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26593424 2015 5' UTR m(6)A Promotes Cap-Independent Translation.
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
25799998 2015 N6-methyladenosine marks primary microRNAs for processing.
25719671 2015 N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
25456834 2014 m(6)A RNA modification controls cell fate transition in mammalian embryonic stem cells.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
24407421 2014 Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.
24316715 2014 A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209618 2013 RNA-methylation-dependent RNA processing controls the speed of the circadian clock.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22575960 2012 Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12355263 2002 Structure prediction and phylogenetic analysis of a functionally diverse family of proteins homologous to the MT-A70 subunit of the human mRNA:m(6)A methyltransferase.
11470232 2001 Expression of the mRNA (N6-adenosine)-methyltransferase S-adenosyl-L-methionine binding subunit mRNA in cultured cells.
9409616 1997 Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.