Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.05
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (2)

PMID Text
23921388 methyltransferase METTL21A is the enzyme responsible for trimethylation of a conserved lysine residue found in several human Hsp70 (HSPA) proteins
23349634 METTL21A trimethylates Lys-561 in Hsp70 and corresponding residues in other isoforms (Hsc70, BiP)

AA Sequence

MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV      1 - 70
ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI     71 - 140
LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQ    141 - 210
KRNQKEDL                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23183491 2014 Genome-wide association study identifies a potent locus associated with human opioid sensitivity.
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
21516116 2011 Next-generation sequencing to generate interactome datasets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.