Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.92
PubTator Score 0.70

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.753 6.2e-06
intraductal papillary-mucinous adenoma (... 1.100 5.2e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
group 3 medulloblastoma 1.500 3.9e-04
Pick disease -1.700 3.5e-07
progressive supranuclear palsy -1.400 2.8e-03
ovarian cancer -1.100 1.9e-05

Gene RIF (4)

26488768 METTL17 is a novel coactivator of estrogen receptors and may play a role in breast tumorigenesis.
24137763 METT11D1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
20877624 Observational study of gene-disease association. (HuGE Navigator)
11278769 Possible component of the small subunit of the mitochondrial ribosome, has similarity to yeast Rsm22 (Ykl155c) mitochondrial ribosomal protein.

AA Sequence

GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES                                      421 - 456

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26488768 2015 Methyltransferase-like 17 physically and functionally interacts with estrogen receptors.
25416956 2014 A proteome-scale map of the human interactome network.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278769 2001 Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues.