Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 0.8
Schizophrenia 1160 0.0 1.2

AA Sequence

MLRYPYFCRMYKECLSCWLESGIPNLGVWPKRIHTTAEKYREYEAREQTDQTQVQELHRSQDRDFETMAK      1 - 70
LHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIR     71 - 140
AMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGRNISSLCYLYT    141 - 210
ERLTTAIYLYCHQDFPGSSHICEQ                                                  211 - 234
//

Text Mined References (2)

PMID Year Title