Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.60
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.600 3.8e-02
oligodendroglioma 1.500 1.9e-02
astrocytoma 1.200 2.4e-23
group 4 medulloblastoma -2.800 5.1e-08
atypical teratoid / rhabdoid tumor -1.800 4.0e-04
medulloblastoma, large-cell -3.300 1.3e-07
breast carcinoma 1.300 8.7e-19
pilocytic astrocytoma 1.400 4.1e-07
subependymal giant cell astrocytoma 1.455 1.3e-02
non-inflammatory breast cancer 1.900 6.7e-03
ductal carcinoma in situ 1.100 4.0e-02
invasive ductal carcinoma 1.800 7.9e-04

Synonym

Accession Q9UJH8 Q9UJH9
Symbols C16orf23
c380A1.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26121675 The joint measurements of circulating METRN levels in the first trimester and systolic blood pressure and weight in the second trimester significantly increase the probabilities of predicting preeclampsia.
15085178 Meteorin plays important roles in both glial cell differentiation and axonal network formation during neurogenesis.

AA Sequence

MGFPAAALLCALCCGLLAPAARAGYSEERCSWRGSGLTQEPGSVGQLALACAEGAVEWLYPAGALRLTLG      1 - 70
GPDPRARPGIACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVRWGPRERRALFLQATPHQDIS     71 - 140
RRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAELLLAACTSDFVIHGIIHGVTHDVELQESVITV    141 - 210
VAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFGEARLGCAPRFQEFRRAYEAA    211 - 280
RAAHLHPCEVALH                                                             281 - 293
//

Text Mined References (7)

PMID Year Title
26121675 2015 Maternal Serum Meteorin Levels and the Risk of Preeclampsia.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15085178 2004 Meteorin: a secreted protein that regulates glial cell differentiation and promotes axonal extension.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.