Property Summary

Ligand Count 66
NCBI Gene PubMed Count 18
PubMed Score 44.38
PubTator Score 18.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 2.4e-18
ovarian cancer 8520 7.5e-07
psoriasis 6694 1.8e-04
interstitial cystitis 2312 3.9e-04
lung cancer 4740 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Babesiosis 14 3.487 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.300 3.9e-04
lung cancer 1.500 6.2e-04
non-small cell lung cancer 1.055 2.4e-18
ovarian cancer -1.200 7.5e-07
psoriasis 1.600 1.8e-04

PDB (29)

Gene RIF (8)

AA Sequence

MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVE      1 - 70
GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMR     71 - 140
LVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRP    141 - 210
LQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHA    211 - 280
QANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRD    281 - 350
GKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF                                      351 - 386
//

Text Mined References (25)

PMID Year Title