Property Summary

NCBI Gene PubMed Count 18
PubMed Score 25.72
PubTator Score 18.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.4e-18
ovarian cancer 8491 7.5e-07
interstitial cystitis 2299 1.0e-05
psoriasis 6685 1.8e-04
lung cancer 4473 6.2e-04
Disease Target Count Z-score Confidence
Babesiosis 13 3.534 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.600 1.8e-04
non-small cell lung cancer 1.055 2.4e-18
lung cancer 1.500 6.2e-04
interstitial cystitis -1.400 1.0e-05
ovarian cancer -1.200 7.5e-07

Synonym

Accession P53582 B4E2E6 MAP 1
Symbols MAP1A
MetAP1A

Gene

PDB

2B3H   2B3K   2B3L   2G6P   2GZ5   2NQ6   2NQ7   4FLI   4FLJ   4FLK   4FLL   4HXX   4IKR   4IKS   4IKT   4IKU   4IU6   4U1B   4U69   4U6C   4U6E   4U6J   4U6W   4U6Z   4U70   4U71   4U73   4U75   4U76  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
23767698 Data indicate that pyridinylpyrimidine-based molecules displayed species specificity behavior against methionine aminopeptidases (MetAPs).
20521764 the substrate specificities of Escherichia coli MetAP1, human MetAP1, and human MetAP2 were systematically profiled
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
17929833 Human MetAP1 is distinct from other members of the MetAP superfamily in the number of metal ions employed and likely mechanism of catalysis.
17114291 results suggest that MetAP1 plays an important role in G(2)/M phase of the cell cycle and that it may serve as a promising target for the discovery and development of new anticancer agents
16274222 A comparison of the structual differences between Type I and Type II methionine aminopeptidases.
12144506 Data show that human methionine aminopeptidase 1 (MetAP1) fully rescued the slow growth phenotype associated with deletion of yeast MetAP1, suggesting that the yeast and human proteins may have similar roles in vivo.

AA Sequence

MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVE      1 - 70
GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMR     71 - 140
LVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRP    141 - 210
LQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHA    211 - 280
QANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRD    281 - 350
GKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF                                      351 - 386
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23767698 2013 Identification, biochemical and structural evaluation of species-specific inhibitors against type I methionine aminopeptidases.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
21269460 2011 Initial characterization of the human central proteome.
20521764 2010 Protein N-terminal processing: substrate specificity of Escherichia coli and human methionine aminopeptidases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17929833 2007 Kinetic and mutational studies of the number of interacting divalent cations required by bacterial and human methionine aminopeptidases.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17114291 2006 Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
16823043 2006 Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
16724298 2006 Identification of pyridinylpyrimidines as inhibitors of human methionine aminopeptidases.
16386852 2006 Methionine aminopeptidase 2 and cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16274222 2005 Structural basis for the functional differences between type I and type II human methionine aminopeptidases.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532271 2003 An unusual peptide deformylase features in the human mitochondrial N-terminal methionine excision pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12144506 2002 Functional expression of human methionine aminopeptidase type 1 in Saccharomyces cerevisiae.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.