Property Summary

NCBI Gene PubMed Count 854
PubMed Score 1856.02
PubTator Score 1522.99

Knowledge Summary

Patent (373,429)

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
lung carcinoma 2844 2.03282673871607E-27
tuberculosis 1563 4.75924725445288E-11
Breast cancer 3099 1.86495298210107E-10
pancreatic cancer 2300 9.68230006249638E-9
breast carcinoma 1614 1.42592235400212E-5
atypical teratoid / rhabdoid tumor 4369 1.96282657294853E-5
pituitary cancer 1972 2.01850935705715E-5
ulcerative colitis 2087 5.26482752109752E-5
invasive ductal carcinoma 2950 1.1406096238612E-4
primitive neuroectodermal tumor 3031 0.00155076122912592
medulloblastoma, large-cell 6234 0.00166885232289452
psoriasis 6685 0.00327534054773331
astrocytic glioma 2241 0.00525915219645605
lung cancer 4473 0.00586379277442461
colon cancer 1475 0.00586976651279178
oligodendroglioma 2849 0.00699200275843855
group 4 medulloblastoma 1875 0.00770565912901172
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0113474641687744
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0114416824743151
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0182697295921983
Barrett's esophagus 185 0.0186239682505018
esophageal adenocarcinoma 737 0.0195207517873976
interstitial lung disease 292 0.0351127092432081
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Upper respiratory tract disease 7 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 6.313 3.2
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count Z-score Confidence
Liver disease 219 3.217 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
glioblastoma -2.700 0.019
osteosarcoma 3.177 0.000
interstitial lung disease 1.200 0.035
astrocytic glioma -2.600 0.005
oligodendroglioma -2.600 0.007
Barrett's esophagus 1.500 0.019
esophageal adenocarcinoma 2.200 0.020
psoriasis -1.100 0.003
atypical teratoid / rhabdoid tumor -3.700 0.000
group 4 medulloblastoma -3.000 0.008
medulloblastoma, large-cell -4.200 0.002
primitive neuroectodermal tumor -3.500 0.002
tuberculosis -6.000 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.018
intraductal papillary-mucinous carcinoma... 1.400 0.011
intraductal papillary-mucinous neoplasm ... 2.000 0.011
colon cancer 2.600 0.006
lung cancer -1.200 0.006
pancreatic cancer 2.300 0.000
breast carcinoma -1.500 0.000
Breast cancer -3.200 0.000
lung carcinoma -3.200 0.000
invasive ductal carcinoma -2.100 0.000
ulcerative colitis 1.300 0.000
ovarian cancer -3.300 0.000
pituitary cancer -2.500 0.000

Synonym

Accession P08581 A1L467 B5A932 E7EQ94 O60366 Q12875 Q9UDX7 Q9UPL8 HGF receptor
Symbols HGFR
AUTS9
RCCP2
c-Met
DFNB97

Gene

MET

PDB

1SHY   4K3J   4O3T   4O3U   1FYR   1R0P   1R1W   1SSL   1UX3   2G15   2RFN   2RFS   2UZX   2UZY   2WD1   2WGJ   2WKM   3A4P   3BUX   3C1X   3CCN   3CD8   3CE3   3CTH   3CTJ   3DKC   3DKF   3DKG   3EFJ   3EFK   3F66   3F82   3I5N   3L8V   3LQ8   3Q6U   3Q6W   3QTI   3R7O   3RHK   3U6H   3U6I   3VW8   3ZBX   3ZC5   3ZCL   3ZXZ   3ZZE   4AOI   4AP7   4DEG   4DEH   4DEI   4EEV   4GG5   4GG7   4IWD   4KNB   4MXC   4R1V   4R1Y   4XMO   4XYF   5DG5   5EYC   5EYD  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (791)

PMID Text
27094128 Report the application of advanced quantitative fluorescence microscopy techniques to study changes in the oligomerization state of the RTK Met in response to stimulation by its endogenous ligand hepatocyte growth factor.
27069297 Results showed that increasing malignancy in cervical tumor resulted in elevated c-Met expression suggesting that c-Met is a potential diagnostic and prognostic indicator of cervical cancer. [Review]
27055285 c-Met expression and activation was not found to be an independent prognostic factor in breast cancer survival outcome.
27030755 This study suggested that GABAA receptor trafficking in the barrel cortex of Met-Emx1 mice is not sensitive to insulin.
26934743 Pre-osteoblasts stimulate migration of breast cancer cells via the HGF/MET pathway.
26905592 Since deregulation of the MET gene leads to cancer and other pathological conditions, a better understanding of the MET regulation is critical for Met-targeted therapeutics
26845230 an "oncogene swap" from EGFR to MET is a novel resistant mechanism to the EGFR-TKI. This novel mechanism should be considered in order to avoid futile inhibition of the original oncogene.
26823824 MET amplification was not related to poor GBM prognosis, but was partially associated with the aggressiveness of gliomas
26801760 Our in vitro and in vivo data suggest KRC-00715 is a potent and highly selective c-Met inhibitor which may have therapeutic potential in gastric tumor with c-Met overexpression.
26791796 There is a significant relationship between MET amplification and protein expression, and selection of tumors with amplification using IHC was effective.
More...

AA Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI      1 - 70
YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT     71 - 140
CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP    141 - 210
LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR    211 - 280
FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK    281 - 350
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF    351 - 420
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV    421 - 490
IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI    491 - 560
CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM    561 - 630
NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK    631 - 700
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV    701 - 770
SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV    771 - 840
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE    841 - 910
WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL    911 - 980
DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT    981 - 1050
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE   1051 - 1120
VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK   1121 - 1190
GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF   1191 - 1260
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF   1261 - 1330
SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS             1331 - 1390
//

Text Mined References (881)

PMID Year Title
27094128 2016 Live cell imaging shows hepatocyte growth factor-induced Met dimerization.
27069297 2016 Diagnosis and Prognostic Significance of c-Met in Cervical Cancer: A Meta-Analysis.
27055285 2016 The Association between EGFR and cMET Expression and Phosphorylation and Its Prognostic Implication in Patients with Breast Cancer.
27030755 2016 Insulin-Independent GABAA Receptor-Mediated Response in the Barrel Cortex of Mice with Impaired Met Activity.
26934743 2016 Pre-Osteoblasts Stimulate Migration of Breast Cancer Cells via the HGF/MET Pathway.
26905592 2016 Regulation of the MET oncogene: molecular mechanisms.
26845230 2016 Oncogene swap as a novel mechanism of acquired resistance to epidermal growth factor receptor-tyrosine kinase inhibitor in lung cancer.
26823824 2015 C-MET overexpression and amplification in gliomas.
26801760 2016 Novel c-Met inhibitor suppresses the growth of c-Met-addicted gastric cancer cells.
26791796 2015 MET amplification, protein expression, and mutations in pulmonary adenocarcinoma.
More...