Property Summary

NCBI Gene PubMed Count 854
PubMed Score 1856.02
PubTator Score 1522.99

Knowledge Summary

Patent (373,429)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Upper respiratory tract disease 7 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 6.313 3.2
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count Z-score Confidence
Liver disease 219 3.217 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
glioblastoma -2.700 1.9e-02
osteosarcoma 3.177 3.1e-07
interstitial lung disease 1.200 3.5e-02
astrocytic glioma -2.600 5.3e-03
oligodendroglioma -2.600 7.0e-03
Barrett's esophagus 1.500 1.9e-02
esophageal adenocarcinoma 2.200 2.0e-02
psoriasis -1.100 3.3e-03
atypical teratoid / rhabdoid tumor -3.700 2.0e-05
group 4 medulloblastoma -3.000 7.7e-03
medulloblastoma, large-cell -4.200 1.7e-03
primitive neuroectodermal tumor -3.500 1.6e-03
tuberculosis -6.000 4.8e-11
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
colon cancer 2.600 5.9e-03
lung cancer -1.200 5.9e-03
pancreatic cancer 2.300 9.7e-09
breast carcinoma -1.500 1.4e-05
Breast cancer -3.200 1.9e-10
lung carcinoma -3.200 2.0e-27
invasive ductal carcinoma -2.100 1.1e-04
ulcerative colitis 1.300 5.3e-05
ovarian cancer -3.300 5.7e-06
pituitary cancer -2.500 2.0e-05

Synonym

Accession P08581 A1L467 B5A932 E7EQ94 O60366 Q12875 Q9UDX7 Q9UPL8 HGF receptor
Symbols HGFR
AUTS9
RCCP2
c-Met
DFNB97

Gene

MET

PDB

1SHY   4K3J   4O3T   4O3U   1FYR   1R0P   1R1W   1SSL   1UX3   2G15   2RFN   2RFS   2UZX   2UZY   2WD1   2WGJ   2WKM   3A4P   3BUX   3C1X   3CCN   3CD8   3CE3   3CTH   3CTJ   3DKC   3DKF   3DKG   3EFJ   3EFK   3F66   3F82   3I5N   3L8V   3LQ8   3Q6U   3Q6W   3QTI   3R7O   3RHK   3U6H   3U6I   3VW8   3ZBX   3ZC5   3ZCL   3ZXZ   3ZZE   4AOI   4AP7   4DEG   4DEH   4DEI   4EEV   4GG5   4GG7   4IWD   4KNB   4MXC   4R1V   4R1Y   4XMO   4XYF   5DG5   5EYC   5EYD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

Protein-protein Interaction (13)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (791)

PMID Text
27094128 Report the application of advanced quantitative fluorescence microscopy techniques to study changes in the oligomerization state of the RTK Met in response to stimulation by its endogenous ligand hepatocyte growth factor.
27069297 Results showed that increasing malignancy in cervical tumor resulted in elevated c-Met expression suggesting that c-Met is a potential diagnostic and prognostic indicator of cervical cancer. [Review]
27055285 c-Met expression and activation was not found to be an independent prognostic factor in breast cancer survival outcome.
27030755 This study suggested that GABAA receptor trafficking in the barrel cortex of Met-Emx1 mice is not sensitive to insulin.
26934743 Pre-osteoblasts stimulate migration of breast cancer cells via the HGF/MET pathway.
26905592 Since deregulation of the MET gene leads to cancer and other pathological conditions, a better understanding of the MET regulation is critical for Met-targeted therapeutics
26845230 an "oncogene swap" from EGFR to MET is a novel resistant mechanism to the EGFR-TKI. This novel mechanism should be considered in order to avoid futile inhibition of the original oncogene.
26823824 MET amplification was not related to poor GBM prognosis, but was partially associated with the aggressiveness of gliomas
26801760 Our in vitro and in vivo data suggest KRC-00715 is a potent and highly selective c-Met inhibitor which may have therapeutic potential in gastric tumor with c-Met overexpression.
26791796 There is a significant relationship between MET amplification and protein expression, and selection of tumors with amplification using IHC was effective.
26791795 de novo MET expression was not rare. It was not a predictive or prognostic factor for stage IV NSCLC patients, but this should be confirmed in larger population cohort.
26790028 we suggest that combinatorial therapeutic strategies with HGF and c-Met inhibitors comprise promising candidates for overcoming sorafenib resistance.
26729443 MET Exon 14 Mutations in Non-Small-Cell Lung Cancer Are Associated With Advanced Age and Stage-Dependent MET Genomic Amplification and c-Met Overexpression.
26719224 This study suggests that MACC1 is an independent prognostic factor in gastric adenocarcinoma and that the prognostic impact of MACC1 may be associated with MACC1 partners other than MET.
26700818 High expression levels of c-met are correlated with glioblastoma.
26637977 Aberrant MET regulation via the juxtamembrane domain subverts core MET receptor functions that regulate osteogenesis within cortical diaphyseal bone.
26636767 Study provides evidence that Chromosome 7 gain drives MET gene copy number increase in papillary renal cell carcinoma tumors, and appears to subsequently lead to an increase in MET protein overexpression in these tumor cells.
26581482 Data show that 11/105 patients failed all molecular analysis: no mutations in oncogenes EGFR, KRAS and NRAS were detected, and no ALK gene rearrangements or MET gene amplifications were identified.
26580964 MET gene amplification and MET receptor activation are not sufficient to predict a positive response of non small cell lung cancers cells to a cocktail of MET and EGFR inhibitors.
26543351 High PI3K p110alpha expression contributes to MET inhibitor resistance in gastric carcinoma xenografts.
26543230 Data suggest stilbenes DIDS, H2DIDS, and derivatives as potential c-Met protein therapeutics.
26505625 The exonic MET variant rs11762213 is an independent predictor of adverse cancer-specific survival and time to recurrence in clear-cell renal cell carcinoma (ccRCC). Genomic analysis demonstrated that this SNP is likely causal in ccRCC.
26497851 Data indicate that oncogene c-Met was a putative target of microRNA miR-139-5p.
26496879 BRCA1-associated DCIS did not express ER, PR or HER2, while most BRCA2-associated DCIS did express ER and PR. BRCA1- as well as BRCA2-associated DCIS had expression of HER3 and C-MET
26472163 heterogeneity of c-Met expression was widely observed in gastric cancer but was not associated with the extent of expression
26459369 c-MET immunostaining in colorectal carcinoma is associated with local disease recurrence
26448928 Moderate concordance of MET expression and significant expression heterogeneity may be a barrier to the development of predictive biomarkers using MET targeting agents.
26436697 High c-Met expression is associated with small cell hypercalcemic ovarian carcinoma.
26408683 Results showed that c-MET Expression is increased in drug-resistant lung cancer cell lines and its inhibition reversed it confirming that activated c-MET is one of the mechanisms by which cells acquire resistance to cytotoxic anticancer drugs.
26402720 Data reported evidence that the SNPs rs76322625 and rs41281081 in the MET 3'UTR are involved in the occurrence of non-small-cell lung cancer. They are respectively regulated by miR-335 and miR-1026 causing up-regulation of MET in patients.
26395411 High MET Gene Copy Number and protein expression is associated with nodal metastases in Non-Small-Cell Lung Cancer.
26384300 Constitutive activation of MET signaling impairs myogenic differentiation of rhabdomyosarcoma and promotes its development and progression.
26375439 Data suggest that proto-oncogene protein c-met (MET )exon 14 deletion (METex14del) is a potential actionable driver mutation in gastrointestinal (GI) malignancies.
26351321 Data show that inhibition of ATP binding cassette subfamily B member 1 (ABCB1) might be a novel therapeutic strategy for non-small cell lung cancer (NSCLC) patients with acquired resistance to proto-oncogene proteins c-met (MET) inhibitors.
26351320 Data show that silencing of fibroblast growth factor receptors FGFR1 or FGFR2 overcomes resistance to the proto-oncogene proteins c-met (MET) inhibitor.
26345996 Met tyrosine kinase inhibitor, PF-2341066, suppresses growth and invasion of nasopharyngeal carcinoma.
26334097 analysis of ARID1A, CDH1, cMET and PIK3CA expression and target-related microRNA expression in gastric cancer
26330547 Results indicate that proto-oncogene protein c-MET (MET) expression was significantly associated with MET amplification.
26325180 miR-206 suppressed c-Met and Bcl2 expression in NSCLS and could function as a potent tumor suppressor in c-Met/Bcl2-over expressing tumors.
26319934 MET activation has a role in poor response to cetuximab in patients with recurrent or metastatic head and neck cancer
26310485 HGF and its receptor, cMET, are antagonized in human lung cancer cells treated with YangZheng XiaoJi
26301867 in H2170 cells and H1975 cells, simultaneous inhibition of key Wnt or mTOR pathway proteins in addition to EGFR and c-Met may be a promising strategy for overcoming EGFR and c-Met TKI resistance in NSCLC patients.
26299665 MicroRNA-31 inhibits lung adenocarcinoma stem-like cells via down-regulation of MET-PI3K-Akt signaling pathway
26282167 HGF/cMET signaling plays and important role in adrenocortical carcinoma growth and resistance to commonly used treatments.
26238632 TPST1 was significantly negatively correlated with the expression of cMet in lung cancer and may be a negative prognostic biomarker of lung cancer.
26229399 In active ulcerative colitis HGFR/CDX2 expressing cells may participate in mucosal regeneration by undergoing mesenchymal-to-epithelial transition.
26227486 CD24 is responsible for the recruitment of phosphorylated Met to the lipid raft domain of the cell membrane, resulting in amplification of the Met signaling cascade.
26225770 results suggest that c-MET network gene expression is a novel prognostic marker for predicting which BCa patients have an increased risk of developing aggressive disease
26216473 TNS1, MET, and TRKC tyrosine-phosphorylated proteins are upregulated during epithelial-mesenchymal transition induced with TGF-beta, and predict the outcome in lung adenocarcinoma patients.
26215952 MET mutations leading to exon 14 skipping were identified in eight (22%) of 36 cases of pulmonary sarcomatoid carcinoma.
26210452 Thus, HGF-stimulated Akt and Erk1/2 signaling as well as proteasomal degradation of HGF activated C-MET are potential therapeutic targets in OS.
26189249 c-met expression in endometrial adenocarcinoma was significantly higher than that in normal endometrial tissues.
26186594 miR-206 suppressed c-Met expression in gastric cancer and could function as a potent tumor suppressor in c-Met overexpressing tumors.
26184032 Overexpression of miR-200a in non-small lung cancer cells significantly downregulates both EGFR and c-Met levels and severely inhibits cell migration and invasion.
26165838 The findings suggest that the oncogenic activity of hepsin arises not only from elevated expression level but also from depletion of HAI-1, events which together trigger gain-of-function activity impacting HGF/MET signalling and epithelial cohesion
26159851 MET GCN gain and CEP7 polysomy could predict a poor outcome in CRC patients, especially CEP7 polysomy has the most powerful prognostic impact in stage II/III CRC patients.
26155941 Data indicate that Met proto-oncogene protein pathway is an important target for cancer therapy.
26143374 Data suggest that targets of RNA interference via MIRN206 (microRNA 206) include MET (proto-oncogene c-met) and EIF4E (eukaryotic initiation factor-4E), in addition to PAX3 (paired box gene 3) and SNX2 (sorting nexin 2).
26141862 Data show that monoclonal antibody ARGX-111 inhibits hepatocyte growth factor (HGF)-dependent proto-oncogene protein c-met (MET) activity by competing with HGF for binding to MET.
26137585 MET suppresses VEGFR2 protein by inducing its endoplasmic-reticulum-associated degradation (ERAD), via intracrine VEGF action.
26115870 Ginsenoside-Rg1-induced angiogenic activities are mediated through the down-regulation of miR-23a and subsequent up-regulation of MET protein expression.
26108200 c-Met identifies a population of matrix metalloproteinase 9-producing monocytes in peritumoural stroma of hepatocellular carcinoma.
26104764 only miR-34a was prognostic for RFS (RR, 11.5; P = 0.027). miR-34a expression was inversely correlated with that of c-MET and CDK6 in non-small cell lung cancer , and had prognostic significance for RFS, especially in adenocarcinoma patients.
26097553 our work reveals a critical relationship of Cox-2/PGE2 and HGF/MET signaling in promoting glioma cells proliferation
26075299 our study provided a miRNA-gene regulatory network in lung cancer metastasis and further demonstrated the roles of miR-206 and MET in this process, which enhances the understanding of the regulatory mechanism in lung cancer metastasis.
26068448 The present pilot study suggests that sc-Met should be further exploited as a biomarker for monitoring of uveal melanoma.
26047809 c-Met overexpression is an adverse prognostic marker in breast cancer, except among Asian and HER-2 positive patients.
26044563 MET levels were regulated by miR-449b in TT cells. Together, we show that reduced miR-449b levels in TT tissues may promote TC growth, through MET-mediated cell proliferation.
26041880 MET protein overexpression and MET gene amplification is associated with non-small cell lung cancer.
26026086 ROCK I provides better efficacy in predicting patient outcomes, compared to either tumor staging or MET expression.
26013381 six different melanocytic tumours carry genomic rearrangements of MET fusing the kinase domain of MET in-frame to six different N-terminal partners
26009992 polymorphisms of the cMET gene were found in patients with pathological complete response to Neoadjuvant chemotherapy exclusively
26006023 Studied the functional role of Met signaling in dedifferentiated liposarcomas.
26000960 Upregulation of EGFR and c-Met is associated with epithelial mesenchymal transition in response to increased matrix rigidity in pulmonary adenocarcinoma.
25996296 Met is a modulator of necrosis, able to protect cells when activated by its ligand but efficiently degraded by proteolysis when this process is engaged.
25987653 we outline the key features of the MET gene, its protein product and the ligand HGF/SF, to provide an overview of this important signalling pathway and offer a summary of the relevant pathological and clinical directions of research.
25985180 identification of an unprecedented role of MET in neutrophils, which suggests a potential 'Achilles' heel' of MET-targeted therapies in cancer, and supports the rationale for evaluating anti-MET drugs in certain inflammatory diseases
25971938 these data support the role of METex14 alterations as drivers of tumorigenesis, and identify a unique subset of patients likely to derive benefit from MET inhibitors.
25965822 MET protein overexpression and gene amplification are independent prognostic factors for OS and DFS in locoregionally advanced nasopharyngeal carcinoma, and may provide therapeutic biomarkers to identify patients in whom MET inhibitors may be beneficial.
25961751 miR-144 acts as a tumor suppressor in uveal melanoma, through inhibiting cell proliferation and migration. miR-144 might serve as a potential therapeutic target in uveal melanoma patients.
25945949 Study identified the G-quadruplex structure in MET promoter and showed its importance in binding to the Sp1 activator promoting tumor growth.
25941349 A missense mutation of MET, encoding the hepatocyte growth factor receptor, is associated with hearing loss in humans.
25940797 Data show that lipocalin 2 (LCN2)-induced migration occurred through activation of the Met protein/FAK protein cascade.
25938344 MET overexpression is more frequent than MET high gene copy number, particularly in high grade non-small cell lung cancers
25935522 Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1).
25927670 miR-144 suppresses GC progression by directly downregulating MET expression, which subsequently prevents activation of the pro-oncogenic Akt pathway.
25923130 While c-MET expression is not a prognostic factor in ACC, its role as a predictive marker of benefit from MET inhibitors deserves further investigation.
25916750 This study suggests that IGF-1R expression could be associated with better clinical outcome in classical Hodgkin's lymphoma but is significantly associated with the expression of MET receptor.
25908454 Results showed that cell viability decreased and apoptosis rate increased in c-MET shRNA-transfected HGF/c-MET pathway-positive MES-SA/Dx5 and MCF-7/ADR2 cell lines in a dose-dependent manner.
25888626 Results strongly suggest that the MET receptor influences the oncogenic properties of cervical carcinoma cells in vitro and in vivo.
25886066 MET gene may be useful in predicting shortened PFS and OS after Gefitinib treatment in lung adenocarcinoma. The correlation between MET gene status and clinical outcomes for EGFR-TKI should be further evaluated using large scale samples.
25880599 Reduced expression of miR-454 in osteosarcoma cells promoted tumor growth by targeting c-Met, thus miR-454 may be a potential therapy target for this tumor.
25875173 c-Met and YKL-40 expression is a reliable predictor of partial/absent response to neoadjuvant chemoradiotherapy in rectal cancer.
25874496 These findings indicate that the miR-1/MET pathway is a potential therapeutic target due to its crucial role in gastric cancer cell proliferation and migration.
25874493 the prognostic significance of MET is limited in early stage disease. MET+/RON+ patients had higher overall recurrence rates than those with the other expression patterns
25869878 Patients with coexpression of both receptors might benefit from cotargeting Notch-1 and c-Met.
25868389 High expression of c-MET gene is associated with papillary thyroid carcinoma.
25862637 Study describes a highly active, non-ligand-dependent mutant of MET in 6% of gliomas, which is not exposed on the cell surface and is predicted to be non-targetable with therapeutic antibodies against MET and/or hepatocyte growth factor
25847631 In clear cell renal cell carcinoma that metastasizes to brain, c-Met overexpression correlates with significantly shorter survival.
25844809 Results show that MET and HGF overexpression were significantly correlated in undifferentiated pleomorphic sarcomas or angiosarcomas suggesting an autocrine activation. These proteins may be potential biomarkers fro these types of sarcoma.
25834821 These results demonstrated that plasma s-Met is a sensitive and reliable marker to detect c-Met overexpression in lung cancers, and it is independent of tumor volume.
25834339 Review/Meta-analysis: high c-Met expression was associated with poor prognosis in patients with colorectal cancer.
25831463 EPAS1 is a key factor in the EGFR-MET crosstalk.
25820598 EGFR, ErbB2 and MET genes are frequently amplified in gastric carcinoma.
25816892 evidence uncovered essential roles of CRK in invasive bladder cancer through the hepatocyte growth factor/c-Met/CRK feedback loop for epithelial-mesenchymal transition induction
25782598 MET gene in the oncogenesis of maxillary carcinosarcoma and is indicative of the common clonal origin of both malignant components.
25775951 These results demonstrate that endometrial carcinoma stromal cells stimulate epithelial cell proliferation via the HGF/c-Met/Akt signaling pathway.
25768032 The MET receptor tyrosine kinase is overexpressed in a subset of NSCLC tumors.
25746038 genetic association studies in populations in Ireland and Belgium: Data suggest that frequencies of mutations in MET, BRAF (B-Raf proto-oncogene), and PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1) vary by demographic location.
25660117 MACC1 overexpression predicted worse prognosis after liver resection, which was attributed to the repression of HCC cell apoptosis via a molecular mechanism in which MACC1 accelerated the activation of the HGF/c-MET/PI3K/AKT pathway
25658794 Expression of CD44, CD47 and c-met was upregulated in OCCC and pairwise correlation. CD44, CD47 and c-met may have synergistic effects on the development of OCCC and are prognostic factors for ovarian cancer.
25653235 miR-206-PAX3-MET signaling is critical to GC metastasis.
25647613 Results show that overexpression of c-MET and its phosphorylation with up-regulation of VEGFR1 are associated with chemo-resistance phenotype of colon cancer.
25645920 Human c-Met can promote increased survival of renal cancer cells through the regulation of HO-1 and PD-L1.
25636446 High c-Met expression levels could predict a poor prognosis in colorectal cancer patients. The c-Met status could be used to evaluate the prognosis in clinical patients.
25633810 miR-93 stimulated cell proliferation, migration, and invasion through the oncogenic c-Met/PI3K/Akt pathway and also inhibited apoptosis by directly inhibiting PTEN and CDKN1A expression in human hepatocellular carcinoma.
25620570 Since c-Met has been identified as a new potential therapeutical target for treatment of hepatocellular carcinoma, damnacanthal could be potentially interesting for the treatment and/or chemoprevention of hepatocellular carcinoma
25611392 The newly identified miR-34c/MET pathway provides further insights into the development and progression of nasopharyngeal carcinoma.
25605252 MET-T1010I SNP may alter breast tumor pathophysiology and should be considered as a potential biomarker.
25592281 These results suggested that the expression of the HGF/cMet pathway in gastric cancer may be a potential predictive factor for disease progression.
25588551 Results show that c-met is overexpressed in 43% of advanced esophageal squamous cell carcinoma (ESCC) and predict a worse efficacy of anti-EGFR therapy suggesting that c-Met may be an independent prognostic factor in advanced ESCC.
25586241 High Hepatocyte Growth Factor Receptor Expression is associated with Perihilar Cholangiocarcinoma.
25584489 Rilotumumab had an exposure-dependent treatment effect in patients with MET-positive gastric or oesophagogastric junction cancer.
25565142 Meg3 overexpression in insulinoma cells down-regulated the expression of the protooncogene c-met.
25541150 residual MET kinase activity can be preserved in the presence of a wide range of concentrations of the competitive MET tyrosine kinase inhibitor crizotinib
25531327 discover a pathway where ETS1 advances melanoma through the expression of MET via PAX-dependent and -independent mechanisms
25522678 Tumor-suppressive miR206 inhibited dual signaling networks activated by MET and EGFR in lung squamous cell carcinoma.
25504327 expression of HGFalpha or cMet was closely correlated with VEGFC, lymphatic microvessel density and metastases of lymph nodes, indicating HGFalpha, cMet and VEGFC may perform important and collaborative actions in lymphangiogenesis and lymphatic metastasis of primary non-small-cell lung cancer
25502629 HGF mediated resistance to alectinib, but not to crizotinib, via the MET signal, that alectinib activated the MET signal in ALK-positive non-small cell lung cancer.
25499462 MET may indicate the presence of cancer stem cells facilitating radioresistance as shown by increased ALDH expression
25492484 Taken together, these results demonstrate that miR-335 suppresses breast cancer cell migration by negatively regulating the HGF/c-Met pathway.
25492085 Two thirds (67%) of lung cancers do not have gains in MET gene copy numbers, whereas 3% show a clear-cut high-level amplification
25489726 The aim was to quantify the level of serum MET DNA, analyze its diagnostic value, and provide a novel biomarker for lung cancer.
25482018 Data indicate that ascites-mediated phosphorylation of proto-oncogene protein c-met (c-Met) is inhibited by c-Met inhibitor PF04217903.
25471370 a novel alternatively spliced inhibitory isoform of Met stimulates muscle cell differentiation, which confers a new means to control muscle differentiation and/or regeneration
25457019 Case Report: response to crizotinib in a patient with MET-mutant papillary renal cell cancer after progression on tivantinib.
25453846 EGFR-mutated patients tended to be female and non-smoker and experienced a prolonged OS suggesting a possible positive prognostic effect. c-MET mutations did not affect survival. Target therapy might be considered in EGFR and c-MET-mutated patien
25427200 c-Met targeting enhances the effect of irradiation and chemical agents against malignant colon cells harboring a KRAS mutation.
25425645 MCM7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor
25416047 Single-nucleotide polymorphism rs41736 located in MET was significantly associated with prognosis of small cell lung cancer Chinese patients.
25405368 We conclude that the decreased expression of the tumor-suppressive miR-23b/27b cluster enhanced cancer cell proliferation, migration and invasion in BC through direct regulation of EGFR and c-Met signaling pathways
25400108 Her2/Her3 and Met/Her3 were verified in human GC.
25381262 Findings establish the importance of MET in prostate cancer progression but show tumors heterogeneity with Met copy-number gain and expression when met gene is amplified.
25364819 this study suggests that MET mRNA expression assessed by RNA ISH could be useful as a potential marker to identify MET oncogene-addicted GC.
25341359 The study reports that two histidine residues separated by a 10-amino-acid spacer (H1068-H1079) located in the juxtamembrane region of c-Met function as a putative novel nuclear localization signal.
25335552 Urinary soluble Met levels distinguish patients with bladder cancer from those without.
25326232 MET amplification was detected in 2.6% of patients with solid tumors and was associated with adenocarcinomas, high-grade histology, and higher metastatic burden.
25323095 There were statistically significant correlations between the expression of PDGFR-alpha, c-Met, and EGFR and disease-free survival
25320014 c-Met upregulated FZD8 through the ERK/c-Fos cascade in HN-CSC. Taken together, our results offer a preclinical proof-of-concept for targeting the c-Met/FZD8 signaling axis as a CSC-directed therapy to improve HNSCC treatment
25314059 MET mutation is associated with neoplasms.
25310337 Therefore, these results suggest that SB365 is good candidate as a natural product for use in the treatment of Met-amplified non-small cell lung cancers
25306394 These findings suggest that TNF-alpha fosters a HGF/MET pro-invasive paracrine loop in tumors.
25305631 Three decades after its discovery the MET oncogene, expressed in normal and cancer stem cells, appears to be a key player in cancer onset and progression. The oncogenic role is sustained both by wild-type MET and by a genetically altered, constitutively activated form. [Review]
25278243 Invasion in LAD cells via inactivation of Akt signaling by targeting c-Met.
25248999 This study provides an assessment of tumor cMET gene copy number changes and protein overexpression incidence in a cohort of Chinese GC patients.
25230070 Report poor prognosis/survival in luminal breast cancer patients with circulating tumor cells co-expressing MET and CD47.
25226813 Tivantinib activity is independent of MET signaling in NSCLC
25220207 This study is the first suggestion of a potential association between c-Met activation and formation of tumor budding/sprouting at the invasive front.
25212607 An autocrine HGF/cMET loop sustains multiple myeloma angiogenesis and represents an appealing new target to potentiate the antiangiogenic management of patients with multiple myeloma.
25211165 Metastatic lesions have higher expression of c-MET expression than primary tumors.
25203738 Results show MET rs40239 may serve as a prognostic biomarker in locoregional gastric cancer and suggest that genetic variants of c-MET may show sex-related differences in the impact on clinical outcome.
25200159 Data indicste that the expressed single-chain variable fragment (scFv) antibody could bind to hepatocyte growth factor receptor (HGFR) specifically.
25194039 Case Report: MET mutation in a supratentorial ependymoblastoma/embryonal tumour with multilayered rosettes.
25187556 HIF-1 and HIF-2 directly activate the expression of AXL and GAS6/AXL signaling uses lateral activation of the met proto-oncogene (MET) through SRC proto-oncogene nonreceptor tyrosine kinase to maximize cellular invasion.
25186085 It is prominently expressed at the site of bone metastasis in renal cell carcinoma.
25148256 reciprocal activating crosstalk between c-Met and CAV1 promoted oncogenic signaling of c-Met contributed to the initiation and progression of HCC.
25135958 Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET.
25109336 Results show that GD3S regulates stem cell function via c-Met and the expression of GD3S is regulated by FOXC2, a transcription factor functioning downstream of several epithelial-mesenchymal transition signaling pathways.
25099011 Our findings reveal for the first time an essential role of nuclear MET association with SOX9/beta-catenin in castration-resistant prostate cancer in vitro and in vivo
25090459 The presented data subclassified colorectal cancers (CRCs) based on their activated signaling pathways and identify a role for c-MET and IGF1R-driven PI3K signaling in CRCs, which is superior to KRAS mutational tests alone.
25087088 Results show that MET genetic abnormalities occur in diverse genitourinary malignancies and are associated with a worse prognosis in a phase I setting.
25084805 cMET has been implicated in the development and/or progression of triple-negative/basal breast cancer and is overexpressed in at least some triple-negative breast cancers
25074413 results provide evidence for a functional role of MET/PAK1 signalling in pancreatic adenocarcinoma
25065564 MET amplification and mutation is associated with metastatic burden and high-grade histology in breast cancer.
25058462 findings display a novel molecular mechanism of c-Met regulation in HCC and strategies to increase miR-181a5p level might be an alternative approach for the enhancement of the inhibitory effects of c-Met inhibitors
24983965 Compared to IHC, SRM provided a quantitative and linear measurement of Met expression, reliably distinguishing between non-amplified and amplified MET tumors.
24973425 MET, HER3, IGF1R, and INSR pathways activation represent novel mechanism underlying lapatinib unresponsiveness in HER2+ gastric cancer. Combination strategy may be recommended in treating patients with HER2+ gastric cancer with these pathways activation
24952592 Data indicate that both hepatocyte growth factor (HGF) and hepatocyte growth factor receptor c-Met are increased after NACT (Neo Adjuvant Chemotherapy).
24947080 In CLI patients a significant decrease in serum HGF levels, concomitant with a loss of skin HIF-1alpha stabilization and a lack of c-Met phosphorylation were seen, probably driving a decrease in wound-healing functions.
24922520 Increased MET gene copy number or protein expression was significantly associated with poorer survival in patients with surgically resected non-small cell lung cancer.
24916572 Results indicate that oridonin exerted anti-tumor growth on gastric cancer SNU-5 in vitro and in vivo by direct regulation of c-Met signaling pathway.
24913906 MET up regulation suggesting role for the MET signaling pathway in the development of these tumors.
24911613 Computation biology data showed that EGFR and MET drive the cancer pathways in glioblastoma individuals.
24901400 ErbB3, ErbB4, and MET showed marked expression in 76%, 98%, and 96% of ovarian carcinoma cases.
24865428 selected 68 different antibodies that compete with HGF for binding to MET. HGF-competing antibodies recognized 4 distinct hotspots localized in different MET domains
24863535 high expression of c-MET in primary tumors increased the risk for tumor recurrence after hepatic metastasectomy in patients with colorectal cancer
24853099 Data show that MET is not overexpressed in urothelial cancer but rather downregulated in a fraction of cancers.
24837198 miR-34a could inhibit Akt [PKB (protein kinase B)] phosphorylation, which was restored by the overexpression of both PDGFR and MET.
24835487 Met needs to traffic to a perinuclear endosome to trigger optimal membrane ruffling, cell migration and invasion.
24828152 USP8 is involved in deubiquitination of LRIG1, influencing the efficiency of Met degradation.
24827412 These results indicated that c-MET overexpression might play an important role in acquired resistance to cytotoxic anticancer drugs
24823486 Activation of c-Met and upregulation of CD44 expression are associated with the metastatic phenotype in the colorectal cancer liver metastasis model.
24814316 Significant correlation between MET and TNS4 expression in human colon carcinoma and ovarian carcinoma suggests TNS4 plays a critical role in MET stability in cancer.
24814255 MET expression is a prognostic factor for disease-specific survival in breast cancer patients receiving neoadjuvant chemotherapy.
24810547 c-Met expression and c-Met gene amplification were not associated with survival outcomes in tonsillar squamous cell carcinoma patients.
24810336 Overexpression of MET is associated with papillary thyroid carcinomas.
24804300 In patients with recurrent/metastatic gastric cancer, MET amplification and strong protein expression are not rare and appear to be significantly associated with unfavorable clinical outcomes.
24802404 Our data indicated that the combination of IR with a MET inhibitor, such as PHA-665752, might be a promising therapeutic strategy for NPC.
24790222 Results indicate that c-Met induces distinct cell morphology alterations depending on the stimulus that activates c-Met.
24786972 Biological, diagnostic and therapeutic relevance of the MET receptor signaling in head and neck cancer.
24777602 These data suggest that inhibition of Pim regulates both the phosphorylation of eIF4B and the levels of MET protein in vivo.
24766640 results suggested that genetic variants in ACAN and MET are associated with HM. Functional roles of ACAN and MET in the development of HM need to be further investigated
24722154 Our study demonstrated for the first time that MET receptor expression, but not MET gene amplification, is significantly increased in ALK(+) NSCLC
24714091 MET inhibitor or SRC inhibitor suppressed phosphorylation of MET and SRC. These results implicate alternative targeting of MET or SRC as rational strategies for reversing cetuximab resistance in colon cancer.
24710956 Receptor-targeted therapeutics for both MET and FN14 are in clinical development, the use of which may mitigate the metastatic potential of NSCLC.
24708867 these results identify Grb2 and Shc as central signaling effectors of Met-driven progression of intestinal epithelial-derived cancers. Notably, they suggest that Grb2 may represent a promising target for the design of novel colorectal cancer therapies.
24687921 MET immunohistochemistry remains the most robust predictor of OS and progression-free survival benefit from O+E relative to all examined exploratory markers.
24658158 The present report expands the role of MET activation as a potential target across all pRCC subtypes. These data support investigating MET inhibitors in pRCC in correlation with MET activation status.
24634221 these data provide evidence in support of a significant role for HGF-induced c-Met/PI3k/Akt signaling and NADPH oxidase activation in lamellipodia formation and motility of lung endothelial cells.
24628993 Data shows that MET and RON are regulated by PAX8 in non-small cell lung cancer.
24626858 Overexpression of MET is associated with gastric adenocarcinoma.
24621885 miR-608 and miR-34a regulate chordoma malignancy by regulating EGFR, MET and Bcl-xL
24615768 Findings suggest that MET may be a therapeutic target in TNBC and that the combined therapy targeting MET and EGFR may be beneficial for the treatment of triple-negative/basal-like breast cancer (TNBC/BLBC)patients.
24609899 findings indicated that miR-199a-3p target HGF/c-Met signaling pathway which is crucial for renal cell carcinoma (RCC) development and suggest that miR-199a-3p may serve as a potential target miRNA for RCC therapy
24596364 High MET expression is associated with breast cancer.
24567328 Migration of MSC to apoptotic cardiac myocytes and fibroblasts was driven by hepatocyte growth factor (HGF), and platelet activation was followed by HMGB1/TLR-4-dependent down-regulation of HGF receptor MET on MSC
24565853 CMet plays no relevant role in most oesophageal squamous cell carcinomas but its overexpression seems to be a key oncogene in about 35% of oesophageal adenocarcinomas, representing a highly promising therapeutic target and prognostic factor.
24562934 Upregulation of MET is associated with subclinical central lymph node metastasis in papillary thyroid microcarcinoma
24518603 Positivity for HER2, MET and FGFR2 alternations was found in 23 (13.4%), 21 (12.2%) and 9 (5.2%) patients.
24510991 c-MET expression in patients with spinal chordoma was found to be correlated with a younger patient age and a favorable prognosis.
24478054 RANK- and c-Met-mediated signal network promotes prostate cancer metastasis or colonization to bone.
24465403 This study shows a low frequency of MET mutations and amplification in this cohort of oropharyngeal squamous cell carcinoma.
24448239 Colon cancer initiating cells rely on MET signaling for resisitance to EGF receptor inhibitors.
24444253 In Alzheimer's disease brains, a marked decline in MET was found in hippocampal pyramidal neurons compared to controls.
24440758 Studies indicate that proto-oncogene proteins c-met (Met) signals post-internalisation from endosomal compartments.
24440350 Inhibition-related MET accumulation is associated with reduced Tyr1003 phosphorylation and MET physical association with the CBL ubiquitin ligase with concomitant decrease in MET ubiquitination.
24416238 higher MET gene amplification and expression in gastric cancer was an indicator of poor prognosis
24393368 The positivity rates for c-MET and phosphorylated-MET were higher in gastric adenocarcinoma than in adjacent tissue, and they were associated with lymphatic metastasis and prognosis.
24390087 The expression of c-Met mRNA was also significantly downregulated.
24389444 Increased MET gene copy number is associated with response to chemotherapy in lung adenocarcinoma.
24389243 These data suggest that tumors displaying MET aberrations achieve plateau responses by MET monotherapy and do not receive further benefit by addition of cytotoxic treatments.
24386407 results suggest that the dual blockade of mutant EGFR and Met by crizotinib and a new generation EGFR-TKI may be promising for overcoming resistance to reversible EGFR-TKIs but careful assessment is warranted clinically.
24354242 High levels of c-Met receptor mRNA in gastric tumor samples are associated with greater depth of invasion, increase in lymphatic metastasis, high frequency of poorly differentiated or undifferentiated tumors, & increase in the gastric cancer staging.
24327519 Collectively, these findings suggest that the combinatorial inhibition of MET and Top1 is a potentially efficacious treatment strategy for Small cell lung cancer .
24326984 CK5/6, but not c-Met expression, seems to be important in lymphatic metastasis
24324260 c-Met and CD44v6 receptors have roles in autocrine TGF-beta1 signaling in interstitial lung disease
24306956 We evaluated HER2 and cMet protein expression, and FGFR2 gene amplification to assess their prognostic significance in patients with gastric adenocarcinoma
24300717 c-Met activation may have a strong influence on keloid pathogenesis. [
24290385 This review showed that MET receptor tyrosine kinase as an autism genetic risk factor.
24285539 LKB1 expression in cancer cell resulted in dephosphorylation of several tumor-enhancing RTKs, including ErbB2, hepatocyte growth factor receptor (c-Met), EphA2, rearranged during transfection (RET), and insulin-like growth factor I receptor.
24284055 MET dependent epithelial-to-mesenchymal transition plays an important role in the adverse clinical behavior of small cell lung cancers.
24259426 miR-26a could suppress tumor angiogenesis of hepatocellular carcinoma (HCC) through HGF-cMet signaling.
24258345 Studies suggest that although serum proto-oncogene proteins c-met (MET) and hepatocyte growth factor (HGF) may serve as predictive biomarkers for MET therapeutics, data do not support their use as pharmacodynamic biomarkers for onartuzumab.
24240654 Subjects with both MET rs1858830 CC genotype and high air pollutant exposures were at increased risk of autism spectrum disorder compared with subjects who had both the CG/GG genotypes and lower air pollutant exposures.
24223894 Studies indicate a significantly poorer overall survival in patients with high c-Met expression.
24222167 c-MET overexpression is associated with hepatocellular carcinoma.
24212721 MET gene copy number gain is associated with stage I lung adenocarcinomas.
24200637 Data indicate that coexistence of EML4-ALK fusion or ALK copy number increase and EGFR, MET, and KRAS mutations in tumor tissue from two treatment-naive Chinese non-small cell lung cancer (NSCLC) patients.
24170771 c-MET inhibitors (tivantinib and crizotinib) suppress the growth of aggressive thyroid cancer cells, and this potential therapeutic benefit results from their non-MET-targeting effects.
24167634 Gefitinib inhibits invasive phenotype and epithelial-mesenchymal transition in drug-resistant NSCLC cells with MET amplification
24150964 C-Met is independently associated with basal-like subtype of breast cancer.
24136235 the Met-dependence receptor in addition to its well-known role in survival signaling mediated by its kinase activity, also participates in the intrinsic apoptosis pathway through the generation of p40 Met.
24124150 High expression of both MACC1 and MET may relate to distant metastasis in colorectal cancer.
24122846 Met can directly inhibit caspase-3 by way of a novel mechanism and promote hepatocyte survival. The results presented here will further our understanding of the mechanisms
24122793 These results suggest that overexpression of TGF-a through induction of EGFR-MET interaction contributes to cetuximab resistance in colorectal cancer cells.
24118504 Our results strongly suggest that paracrine HGF-induced activation of MET-mediated signaling pathways plays an important role in the pathogenesis of peritoneal carcinomatosis in scirrhous gastric cancer.
24115218 our findings indicate that EGFR inhibition in GBM induces MET activation in GSCs, which is a functional requisite for GSCs activity and thus represents a promising therapeutic target.
24114941 These findings reveal a novel, specific inhibitory function of LECT2 in hepatocellular carcinoma by the direct binding and inactivation of MET.
24094902 activation through phosphorylation is assosiated with micropapillary pattern and small cluster invasion in lung adenocarcinoma
24016866 Decorin may interfere with angiogenesis by downregulating hypoxia-induced Met, Rac1, HIF-1alpha and VEGF expression in RPE cells, which suggests a potential strategy for the inhibition of CNV.
23992325 This review describes the critical role of the HGF/c-Met pathway in cancer, as well as the preclinical and clinical investigations on c-Met inhibitors in solid tumors, with emphasis on small-molecule inhibitors in gastrointestinal cancers. [review]
23973484 Knockdown of 6PGD significantly inhibited phosphorylation of c-Met at tyrosine residues known to be critical for activity. This downregulation of c-Met phosphorylation correlated with inhibition of cell migration in vitro.
23944359 discuss the SOCS1-dependent regulation of MET signaling as an important mechanism underlying the tumor suppressor role of SOCS1 that is relevant not only to hepatocellular carcinoma but also to other types of cancers.
23922103 a significant inverse correlation between miR-34c expression levels and MET immunostaining was found in prostate cancer patients. These findings provide a novel molecular mechanism of MET regulation in prostate cancer.
23919423 evaluated mutations in four driver genes, epidermal growth factor receptor (EGFR), Kirsten ras oncogene (KRAS), c-MET, and echinoderm microtubule-associated protein-like 4-anaplastic lymphoma kinase (EML4-ALK), in Chinese lung adenocarcinoma patients
23898085 increased tumor c-MET and HGF expressions were associated with favorable disease attributes but not with survival.
23882082 Data indicate that binding between hepatocyte growth factor (HGF)-alhpa and tyrosine kinase MET was disrupted by onartuzumab.
23877345 The results indicated that long-term androgen deprivation resulted in a signaling pathway switch from AR to c-Met in androgen-sensitive cells, which was confirmed by immunofluorescence imaging and western blot analysis
23873272 MET activation can mediate resistance even to dual anti- ERbB therapies, suggesting a focus for possible deliberate molecular design of multi-targeted therapeutics- in this case, targeting both MET and ERBb pathways
23867513 Given these findings, the c-Met pathway is a logical therapeutic target in RCC, and several agents are in clinical testing with early signs of efficacy.
23861540 Network models inferred from the data revealed a conserved set of signaling pathways and RTK-specific features that grouped the RTKs into three distinct classes: (i) an EGFR/FGFR1/c-Met class ; (ii) an IGF-1R/NTRK2 class; and (iii) a PDGFRbeta class.
23841470 Amplication of the MET protooncogene has been associated with resistance to gefitinib or erlotinib in about 5% of patients, initially responsive to the drug. Somatic mutations in the TK domain of MET have been described in non-small cell lung cancer
23825050 findings show that a significant percentage of breast tumors coexpress MET and ERBB2; ERBB2(+) breast cancers with MET(+)/ERBB2(+) subpopulations may have an innate resistance to ERBB2 inhibition
23820886 The pro-metastatic gene c-Met as a potential miR-409-3p target.
23812675 Studied the expression of MACC-1 and c-MET in gastric cancer, and correlated this expression with clinicohistological parameters and patient prognosis.
23807774 MET overexpression is an independent prognostic factor in gastric carcinomas
23802768 evaluated the survival impact of MET expression in patients with BRAF(V600E/K) advanced melanoma treated with vemurafenib
23801885 data suggest that the c-Met-N375S sequence variant may not play a significant role in cancer susceptibility and the prognosis of lung cancer patients
23799130 The expression of ST3GAL4 leads to SLe(x) antigen expression in gastric cancer cells which in turn induces an increased invasive phenotype through the activation of c-Met
23792586 The mechanism of increased invasiveness upon EGFR and p53(R175H) expression may be the result of increased c-Met activation.
23746173 the proteolytic activity of ADAM10/17 is essential for regulating HGF/c-Met signalling during acute liver damage and following regeneration.
23745832 The MET(-) RON(-) phenotype retained its prognostic impact after subgroup analysis.
23740136 c-Met immunohistochemical expression is an independent predictor of outcomes in patients with glioblastoma multiforme treated by standard of care.
23734217 Data show that the expression of miR-449a was reciprocally correlated with c-Met in non-small cell lung cancer (NSCLC) tissues.
23695554 Review discusses issues related to identification of tumorigenic clones driven by MET in the context of genetically heterogeneous tumors and strategies aimed at eradicating cancer stem cells.
23677180 the reduced expression of phosphor-EGFR and c-MET is chiefly responsible for all events of blocking metastasis
23671132 These findings suggest that SB365 docks at an allosteric site on c-Met and thereby targets c-Met signaling pathway, cell growth/angiogenesis inhibition and apoptosis induction.
23665680 Met-induced blebbing has an important role in cell detachment, amoeboid motility and invasion ability, which are utilized by cancer cells for migration and metastasis
23659968 Our findings point to a tumor suppressor role for ETS2 in human NSCLC pathogenesis through inhibition of the MET proto-oncogene.
23650389 miR-27a regulates MET, EGFR, and Sprouty2 in lung cancer.
23648337 AXL and MET crosstalk to promote gonadotropin releasing hormone (GnRH) neuronal cell migration and survival.
23625089 The data reveal the novel function of c-Met in the process of brain metastasis and its potential as a preventive and/or therapeutic target in this disease
23618864 Data indicate that miR-101 directly targets c-Met via its 3'-UTR.
23583448 Cross-talk between FPR2 and HGF receptor in human prostate epithelial cells.
23558571 Suggest that MET and MST1R are independent prognostic factors in classical classical Hodgkin's lymphoma, and may allow the identification of a subgroup of cHL patients who require more intensive therapy.
23548264 our findings indicate the therapeutic potential of targeting both c-Met and VEGFRs simultaneously with a single small-molecule inhibitor for the treatment of human cancers
23546020 MET and EGFR are overexpressed in esophageal carcinosarcoma suggesting molecular targeted therapies might be an effective line of treatment.
23536000 High expression of c-Met is closely related to tumor metastasis in colorectal carcinoma patients.
23532910 HGF and Met may exert functions in the development of Synchronous liver metastasis when concurrent with lymph node metastases but had little influence on SLM without lymph node metastasis
23526299 IGF-1-induced delayed MET activation occurs in cell lines which express both receptors, suggesting that IGF-1R-mediated MET activation may contribute to tumorigenic properties of multiple cancer types when both growth factor receptors are expressed.
23520442 Although the overall percentage of patients exhibiting c-MET amplifications (6.1% [4/66]) did not change with Neoadj-Chemo, two patients transitioned from negative to positive c-MET amplification, and two patients reversed these changes post-Neoadj-Chemo
23490239 The majority of penile squamous cell carcinomas exhibit c-MET expression which is not associated with oncogene amplification, but might be attributable to polysomy-7.
23470965 Data indicate that EGFR T790M as the most common mechanism of acquired resistance, whereas MET amplification, HER2 amplification, and small cell histologic transformation occur less frequently.
23469222 MET is the most frequently amplified gene in endometriosis-associated ovarian clear cell adenocarcinoma and correlates with poor prognosis.
23467907 HGF/c-Met pathway signaling may influence OVCA chemosensitivity.
23456500 MYO5B is epigenetically silenced in gastric cancer cells by DNA methylation and histone modification. Inactivation of MYO5B in gastric cancer cells expressing MYO5B inhibits HGF-stimulated MET degradation with sustained c-MET levels and signaling.
23449277 Results document MET mutations in anaplastic lymphoma kinase-rearranged (ALK+) lung adenocarcinomas. The pathogenic role of these MET mutations is not entirely clear.
23431957 MET expression is higher in advanced versus no/limited multiple myeloma lytic bone disease. All bone marrow biopsies show MET expression.
23410046 Soluble serum c-Met expression correlates with the tumor c-Met expression level and tumor size in humans; high soluble c-Met predicts poorer outcome.
23386689 We found that HGF coexpression is a key predictor of response to c-MET inhibition among the examined factors and identified an ERK/JAK/p53 pathway activation signature that differentiates c-MET inhibition in responsive and nonresponsive cells
23381625 Radiation Upregulates c-Met Expression and Signaling Activity in Human Breast Cancer Cell Lines.
23379953 Report MET copy number gain as a poor prognostic factor in primary intestinal diffuse large B-cell lymphoma.
23360489 Silencing of SNX2 markedly alters sensitivity to anticancer drugs targeted to c-Met.
23359207 Suppression of STAT3 phosphorylation with WP1193 reduced HGF expression in DeltaEGFR-expressing GBM cells.
23354516 MET and associated genes showed a clear deregulation in vestibular schwannomas.
23348694 KRC-408 is a novel therapeutic candidate effective against gastric cancers that overexpress c-Met, inhibiting cell proliferation and angiogenesis.
23335077 MET and ALK may have roles in poor survival in Ewing sarcoma
23327903 Data indicate that the median MET copy number in 266 cases of gastric cancer was 1.7, with a range of 0.41 to 21.3.
23327059 c-Met oncogene overexpression is an important parameter in cervical early oncogenesis and may have a role in malignant transformation of cervical epithelial cells.
23320110 HGF enhances migration of chondrosarcoma cells by increasing matrix metalloproteinase-2 expression through the c-Met receptor/PI3K/Akt/PKCdelta/NF-kappaB signal transduction pathway..
23314853 NK4 has anti-proliferative and anti-invasive effects in cholanciocarcinoma mediated the HGF/Met pathway.
23314612 findings show that miR-34b may play an important role in non-small cell lung cancer progression; miR-34b downregulates Met, with subsequent changes of downstream p53 and Mdm2, and inversely p53 upregulates miR-34b in a feedback loop
23296269 Studies indicate that NK4 hepatocyte growth factor fragement inhibits hepatocyte growth factor (HGF)-mediated hepatocyte growth factor receptor MET tyrosine phosphorylation by competing with HGF for binding to MET.
23288161 Neuropilin-1/c-met signalling pathway mediates rhodocetin-alpha,beta restructuring of matrix contacts in endothelial cells.
23258844 High MET signaling is associated with glioblastoma.
23243217 Silencing of miR-34a and upregulation of c-Met, Snail, and beta-catenin expression is associated with liver metastases of colon cancer.
23242174 Aberrations of MET are associated with EGFR and PTEN signalling and might possess relevance for targeted therapies of salivary gland carcinomas in the future.
23219378 Patients with localised renal-cell carcinoma and the MET polymorphism rs11762213 might have an increased risk of recurrence after nephrectomy.
23212923 S1PR1 and ITGB4 transactivation are rate-limiting events in the transduction of HGF signals via a dynamic c-Met complex resulting in enhanced EC barrier integrity
23208509 LRIG1 mediates degradation of Met by SAIT301 and this degradation does not require Met activation.
23193156 The effect of MUC1 and EGF on these phenotypes was dependent upon c-Met activity.
23123275 MET dimerization by the HGF splice variant NK1 may be ligand-mediated with a NK1 dimer at the center of the 2:2 complex with one MET molecule bound peripherally to each NK1. (Review)
23097380 MET receptor tyrosine kinase has been proposed as a candidate risk gene for autism spectrum disorder.
23094709 polymorphisms in our study groups suggests that polymorphisms in the minimal promoters of these genes are not involved in the pathogenesis of ROP.
23060267 Glycosylation is required for c-Met membrane targeting.
23049908 Met kinetic signature derived from the response to HGF/SF in a cellular model predicts breast cancer patient survival
23028720 These results describe a unique role for EGFR and Met in mammary epithelial cells.
23024367 the link between p38 and c-Met is implicated in the progression of human cholangiocarcinoma.
23022995 c-Met is associated with poor pathologic features and prognosis in renal cell carcinoma
23006961 Results of the current study suggested that DCP and c-Met are commonly and concurrently expressed in hepatocellular carcinoma.
23001699 Low c-Met is associated with gastric cancer.
22996389 The binding ability of mouse HGF alpha-chain, or of beta-chain, to human c-Met was lower than that of human HGF.
22976495 Co-expression of c-Met and Integrin alpha5beta1 has mechanical significance in the early stages of human gastric cardia adenocarcinoma.
22973954 In small cell lung cancer and neuroendocrine tumors MET mutations are relatively rare; detected mutations were located in the juxtamembrane domain and were of no functional relevance as they did not influence c-Met phosphorylation
22962849 the crosstalk between MUC1 and c-Met in HCC could provide an advantage for invasion to HCC cells through the beta-catenin/c-Myc pathway.
22958829 We show that a common, functional autism spectrum disorder (ASD) risk variant in the Met Receptor Tyrosine Kinase (MET) gene is a potent modulator of key social brain circuitry in children and adolescents with and without ASD.
22915589 an anti-apoptotic role of caspase-cleaved GAB1 in HGF/SF-MET signaling.
22890162 c-met overexpression in SSC fibroblasts may be a negative feedback against cutaneous fibrosis.
22887347 Results suggest the interaction of the Cap domain of InlB from one and the Sema domain of MET from another 1:1 complex is not physiologically relevant and support the previously proposed assembly of a 2:2 InlB:MET complex is built around a ligand dimer.
22850551 High GCNs of MET and HGF associate with an increased risk of trastuzumab-based therapy failure in HER2-positive MBC.
22833194 Genetically determined decrease in MET protein production may lead to a reduction in immune regulation in mothers who produce autism-associated antibodies to fetal brain proteins.
22815748 Met signaling regulates the secretion of the pro-angiogenic chemokine interleukin-8/CXCL8
22814258 MACC1 and c-met have an important function in the differentiation, invasion, and metastasis of NSCLC
22789536 demonstrate that vascular endothelial growth factor (VEGF) directly and negatively regulates tumor cell invasion through enhanced recruitment of the protein tyrosine phosphatase 1B (PTP1B) to a MET/VEGFR2 heterocomplex
22750473 miR-410, a direct regulator of MET, may function as a tumor suppressor in human gliomas.
22738909 our findings suggest that Met is a functional marker of glioblastoma stem cells and a candidate target for identification and therapy of a subset of glioblastomas.
22733437 Results show that the cellular receptors, FAK, CD44v6, c-Met and EGFR, are biomarkers of survival and tumour progression in colorectal cancer. Increased staining for each receptor was also followed by expression elevation of at least one other marker.
22717761 A missense mutation (c.3328G > T, p.Val1110Leu) in the c-MET gene was identified in a family with hereditary papillary renal carcinoma.
22704061 C-Met proto-oncogene enhances the migration and invasion of tongue cancer cells through the expressions of matrix metalloproteinase-1, -2, and -9, and promotes tongue cancer cell growth
22689693 HGF down-regulated c-Met receptor expression, whereas it up-regulated pro- and active/mature forms of ADAM10 and ADAM17 expression, which resulted in enhanced sMet production
22683780 These results show a widespread dependence of acute myeloid leukemia cells on autocrine activation of MET.
22672415 The results of yhis study suggested that MET gain was also common in diffuse astrocytomas (38%), but less frequent in oligodendrogliomas (16%). MET gain in diffuse astrocytomas was associated with shorter survival.
22660439 report here the results of a genome-wide short hairpin RNA screen for genes that are lethal in combination with p53 activation by Nutlin-3, which showed that the ATM and MET kinases govern cell fate choice upon p53 activation
22644302 MET protein overexpression was observed in 104 of 438 cases.
22640970 c-MET oncogene protein was frequently overexpressed in Iranian gastric carcinomas
22635005 identified an exosome-specific melanoma signature with prognostic and therapeutic potential comprised of TYRP2, VLA-4, HSP70, an HSP90 isoform and the MET oncoprotein
22624713 Reduced LFNG expression facilitates JAG/NOTCH luminal progenitor signaling and cooperates with MET/CAVEOLIN basal-type signaling to promote basal-like breast cancer.
22617325 MET activation in glioblastoma is a functional requisite for the cancer stem cell phenotype and a promising therapeutic target.
22606006 amplification of ERBB4, C-MET and CD44 was significantly associated with certain clinicopathological characteristics, particularly tumor differentiation and cancer-related death and poor survival.
22590625 a novel mechanism of action of perifosine, directly inhibiting EGFR/MET-AKT1/3 axis, providing a rationale for a novel translational approach to the treatment of MMe.
22580609 Hugl-2 induces MET and suppresses Snail tumorigenesis.
22558359 The findings indicate that MET variances and MET/AKT interaction may affect facial emotion perception.
22535954 Fas ligand enhances malignant behavior of tumor cells through interaction with Met, hepatocyte growth factor receptor, in lipid rafts.
22526456 immunohistochemical analysis of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary
22495710 The HGF/c-Met signaling pathway may be involved in the pathogenesis and progression of colon cancer. C-Met overexpression can be used as a useful parameter to evaluate the prognosis of colon cancer.
22493396 High expression of MACC1 or MET was associated with reduced relapse-free survival and the prognosis was worse when both genes were highly expressed
22447520 To determine if mutation of HGF/MET pathway genes is a mechanism for pathway dysregulation, conducted a mutational analysis of three key components of this pathway: SPINT1, SPINT2, and MET, in 32 primary human medulloblastoma specimens.
22418436 context-specific processing of c-Met protein is implicated in HCC progression in stressful microenvironments.
22407230 In human gastric cancer cell line SGC7901 cells, Lentivirus-mediated RNAi significantly reduced both c-Met mRNA and protein expression, which resulted in suppressing the cell proliferation, invasion and adhesion to peritoneum.
22395988 High phosphorylated-c-Met is associated with early distant organ metastasis in pancreatic ductal adenocarcinoma.
22389872 The Met signaling pathway did correlate with MetMAb treatment response initially and at the time of recurrence.
22383989 SRC, c-MET and CRK play a key role in gastric carcinogenesis by modulating CagA signal transductions and interaction between CRK gene and phytoestrogens modify gastric cancer risk
22374333 high levels of cMET and p-cMET were seen in all breast cancer subtypes and correlated with poor prognosis
22367914 MET initiates the transformation of a cell population that has features of osteo-progenitors.
22366451 Met signals through a cortactin-Gab1 scaffold complex, to mediate invadopodia.
22343615 miR-1 can have a tumor suppressor function in colorectal cancer by downregulating MET oncogene both at RNA and protein level and that reexpression of miR-1 leads to MET-driven reduction of cell proliferation.
22343486 c-Met, epidermal growth factor receptor, and insulin-like growth factor-1 receptor are important for growth in uveal melanoma and independently contribute to migration and metastatic potential
22301273 results demonstrate the involvement of the disialoganglioside G(D2) in MDA-MB-231 cell proliferation via the constitutive activation of c-Met
22276607 Expression of c-Met is one of the factors that distinguishes normal from malignant plasma cells and indicates that the HGF/c-Met system is activated in multiple myeloma patients.
22262855 Met-dependent Cbl loss may also promote cross-talk through indirect enhancement of EGF receptor signaling.
22246193 Plasma cell membrane localization of c-MET is associated with malignant mesothelioma.
22238368 Data indicate that MET-mediated resistance to lapatinib is a novel mechanism of resistance to HER2-targeted agents in gastric cancer cells.
22237262 MET gene copy number by silver in situ hybridization and protein expression is not associated with non-small cell lung carcinomas.
22218908 Although c-Met expression was not significantly associated with c-Met gene amplification, it may be a useful predictive marker of recurrence in resected HCC patients.
22207554 Increased MET copy number and MET overexpression are negative prognostic factors for surgically resected in non-small cell lung cancer
22198430 High c-MET/phospho-MET protein expression and MET gene copy number is associated with nonsquamous non-small cell lung carcinomas.
22194599 inhibition of Met, hypoxia inducible factor 1alpha, vascular endothelial growth factor A, and induction of thrombospondin-1 and TIMP3 by decorin
22188814 Data show that c-Met induces FAK and Pyk2 phosphorylation in medulloblastoma cells.
22180430 expression of c-Met in tumor cells from patients with classical Hodgkin's lymphoma strongly correlated with a favorable prognosis in two independent cohorts.
22179665 Concomitant downregulation of miR-1 and increase of MACC1 can thus contribute to MET overexpression and to the metastatic behavior of colon cancer cells.
22172411 The expression of ezrin, HGF and/or c-met might be closely related to the carcinogenesis, progression, clinical biological behaviors and prognosis of gallbladder adenocarcinoma.
22157681 these results are the first to identify EGFR and MET-receptor-regulated miRNAs representing oncogenic signaling networks in NSCLCs.
22152933 The structure of the MET receptor, the activated pathways, the main genomic anomalies in lung cancer & the development of MET inhibitors are reviewed. Review.
22137795 multiple receptor tyrosine kinases are amplified in a subset of glioblastoma subclones, epidermal growth factor receptor, MET and platelet-derived growth factor receptor alpha
22135723 overexpressions of FASN and p-c-Met were observed in a subset of thyroid carcinomas of follicular origin
22127603 Immunohistochemical characterization of HGF/C-MET system pathways in benign and malignant histotypes of thyroid nodules.
22110649 MET variants may be relevant to autism susceptibility in the Chinese Han population
22110593 c-MET regulates tumour infiltration in surrounding tissues putatively by acquisition of a stem-like phenotype.
22105362 PAK1 as a breast cancer oncogene that coordinately regulates multiple signaling pathways
22081023 Met stimulates hepatocyte glucose uptake through crosstalk with insulin receptor.
22052229 High MET gene dosage was not related to primary tyrosine kinase inhibitor resistance and the incidence was increased after chemotherapy, suggesting high MET gene dosage may also be related to chemotherapy resistance.
22047509 Review: Report role of monoclonal antibody MetMAb/OA-5D5 in c-MET active lung neoplasms.
22045810 Protein-tyrosine phosphatase 1B modulates early endosome fusion and trafficking of Met and epidermal growth factor receptors.
22042954 qPCR revealed approximately 10% of white patients with gastric cancer harboring MET copy number gain (CNG)of five or more copies.
22032640 Met and EGFR to be released from lipid rafts, thus leading to their activation in a ligand-independent manner.
22027690 Overall, our findings highlighted the effectiveness of c-MET inhibition in delaying the onset and progression of bone metastases.
22020736 c-Met is more likely to be activated in both NRAS-mutated and wt/wt melanomas; melanoma cells with these genotypes, particularly NRAS mutants, are more sensitive to pharmacologic c-Met inhibition
21983935 Accumulative MET gene copy number alterations causing MET overexpression are associated with higher tumor grade and might drive the development and progression of the MET amplification-positive ovarian clear-cell adenocarcinoma.
21982684 both primary and lymph-node metastases have relatively consistent EGFR mutations and EGFR mutations are not relevant to changes in c-Met gene copy number.
21970370 this is the first report also implicating this MET genetic mutation as a germline inherited risk factor for familial colorectal cancer.
21949730 the molecular signatures of liver cancer in a c-MET-transgenic mouse model
21922276 Data suggest that c-Met plays an oncogenic role in the development of NPC and as a potential novel therapeutic target for NPC.
21922134 Elevated cancer cell cMET and stromal HGF expression were significantly associated with a worse prognosis
21920521 HGF induces vascular smooth muscle cell osteogenic differentiation via c-Met/Akt/Notch3 signalling, highlighting these pathways as potential targets for intervention of vascular calcification.
21917713 ability of MET receptors and effectors to be spatially controlled by the endosomal recycling pathway may play a prominent role in cellular functions such as motility
21872356 suggest that abnormality of the HGF/MET pathway occurs during the course of progression from non-invasive to invasive pulmonary adenocarcinoma
21832174 Expression of MET in restricted human neocortical regions and its regulation in part by FOXP2 is consistent with genetic evidence for MET contributing to autism spectrum disorder risk.
21831840 These results also show that the extent of advanced cancer traits, such as invasion, may be determined by alterations in individual components of p53/MET regulatory network.
21796631 study demonstrated that the HGF/c-Met pathway induces epithelial-mesenchymal transition and inhibition of anoikis in gastric cancer cells. Co-expression of HGF and c-Met has the potential to promote peritoneal dissemination in gastric cancer
21782801 These data demonstrate that GAB1 is ubiquitinated by CBL and degraded by the proteasome, and plays a role in negative-feedback regulation of HGF/SF-MET signaling.
21779788 Met overexpression, but not met mutation, correlates with progression of non-small cell lung cancer.
21751142 The results demonstrated that both Ezrin and c-Met overexpression were related to the occurrence and progression of gastric carcinoma
21733594 MET positive cases according to the Cappuzzo scoring system evidenced both aneuploidy and true amplification.
21729677 IGF1R overexpression is associated with resistance to cetuximab in metastatic colorectal cancer.
21716144 MET mutation is associated with treatment response in non-small cell lung cancer.
21706050 Data show that showed that miR-130a, expressed at low level in lung cancer cell lines, by targeting MET was able to reduce TRAIL resistance in non-small cell lung cancer (NSCLC) cells through the c-Jun-mediated downregulation of miR-221 and miR-222.
21703197 Secreted OPN, induced by LSF, activates c-Met via a potential interaction between OPN and its cell surface receptor CD44. A significant correlation was observed among LSF, OPN, and activated c-Met levels in HCC.
21697284 The observed spectrum of mutations in NVP-BVU972-resistant cells was dominated by substitutions of tyrosine 1230 which plays a key role in inhibitor binding.
21687954 High level of MET and SOX2 expression were respectively demonstrated in ADCs and SCCs; MET activation was accompanied with exon 19 deletion in ADCs.
21680714 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21673683 Overexpression of c-Met oncoprotein is associated with cholangiocarcinoma.
21658389 Data show that miR-198 targets c-MET via its 3'UTR, and that forced expression of miR-198 decreased c-MET expression and diminished HGF-induced phosphorylation of p44/42 MAPK.
21642981 Oncogenicity of Met mutants results not only from activation but also from their altered endocytic trafficking, indicating that endosomal signalling may be a crucial mechanism regulating receptor tyrosine kinase-dependent tumorigenesis.
21628563 Findings show that c-Met enhances the population of glioblastoma stem cells via a mechanism requiring Nanog and potentially other c-Met-responsive reprogramming transcription factors.
21623265 MET amplification is associated with non-small cell lung cancer.
21622718 Combined targeting of c-Met and EGFR resulted in an enhanced inhibition of tumor volumes accompanied by a decreased number of proliferating cells and increased apoptosis compared with single agent treatment in vivo.
21595927 These studies are the first confirm that interference with the HGF/c-met/Stat3 signaling pathway can block tumor cell invasion in an in vivo model.
21540237 pMET expression was an independent prognosticator of poor patient outcome
21531000 important prognostic significance of c-Met for patients with oral squamous cell carcinoma.
21514418 Decreased antiapoptotic Met signaling in podocytes could contribute to podocyte loss and focal and segmental glomerulosclerosis in Transplant glomerulopathy
21504731 the role of SEPT2 and SEPT11 in the InlB-Met interactions
21500189 Four biomarkers were identified that appeared to be strongly and consistently modulated by Met inhibition in a panel of Met-addicted gastric carcinoma cell lines.
21496277 In addition to c-Met, the cross-talk with Axl and/or PDGFR-alpha also contributes to the progression of human bladder cancer
21486864 chronic lymphocytic leukemic cells express a functional hepatocyte growth factor receptor (c-MET) and hepatocyte growth factor enhanced the viability of these cells through STAT3 phosphorylation
21478826 ovarian carcinomas, the amplification of the MET proto-oncogene is highly selective and commonly occurs in clear-cell adenocarcinoma.
21468575 The down-regulation of c-Met inhibits proliferation and invasion and increases the chemosensitivity of U266 cells.
21455220 c-Abl interconnecting Met-RTK and p53 core pathways, and its inhibition impairs Met-dependent tumorigenesis. Met ensures cell survival through a new path in which c-Abl and p38-MAPK are employed to elicit p53 phosphorylation and Mdm2 upregulation.
21454675 RPTP-beta is a key regulator of Met function.
21454604 Discovery of a novel mode of protein kinase inhibition characterized by the mechanism of inhibition of human mesenchymal-epithelial transition factor (c-Met) protein autophosphorylation by ARQ 197.
21447729 Expression analysis of MET, MACC1, and HGF in metastatic colorectal cancer.
21445634 in ileal neuroendocrine cancer, HER-2/neu overexpression plays a role in the carcinogenetic process and by triggering the altered expression of c-Met and MTA-1, may activate the molecular pathway(s) promoting tumor progression and metastasis development.
21424128 These results suggest that the increased MET copy number plays an important role in determining prognosis in gastric cancer patients
21423210 Combined targeting of c-Met and EGFR leads to increased xenograft antitumor activity
21412276 Increased neuronal Met in amyotrophic lateral sclerosis met-transgenic mice prolongs life span, retards motor neuron and delay disease onset loss.
21393565 High MET expression and gene amplification is not associated in Western patients with gastric cancer.
21383285 ARQ 197 safely inhibited intratumoral c-MET signaling.
21354913 EGFR and c-Met may interact in a synergistic manner in the oncogenesis and development of non-small cell lung cancer. Expressions were higher in smokers than in nonsmokers.
21302810 Tumor MET expression may not predict the risk of venous thromboembolism in cancer patients.
21299348 Report variable expression of MET in different variants of renal cell carcinoma.
21247903 the role of structural plasticity within the kinase domain in imparting the specificity of ligand binding and provide the framework for structure-guided design of activated c-Met inhibitors.
21242965 findings denote hTid-1(S) as an essential regulatory component of MetR signaling
21223687 There is a positive correlation between the EGFR and c-Met protein expression and the differentiation of non-small cell lung cancer.
21222362 uncoupled Met down regulation likely functions to amplify the oncogenic signaling of Met in pancreatic tumor cells.
21220347 Data indicate that MET and LRRK2 cooperate to promote efficient tumor cell growth and survival in these cancers.
21217780 matriptase as an initiator of c-Met-Akt-mTor-dependent signaling axis in tumors and mTor activation as an essential component of matriptase/c-Met-induced carcinogenesis
21212418 Our findings establish that oncogene addiction to MET involves Ron transactivation
21168200 HGF and c-Met may play a role in the progression of endometrial cancer
21163258 both binding and orientation is dictated by the c-MET phosphorylated tyrosine and an adjacent arginine forming intra-peptide hydrogen bonds and aligning unidirectionally with complementary charges in the phosphotyrosine binding pocket of c-Cbl.
21119598 fibronectin promotes ovarian cancer invasion and metastasis through an alpha(5)beta(1)-integrin/c-Met/FAK/Src-dependent signaling pathway.
21098327 Case Report: CCND1 and MET genomic amplification during malignant transformation of a giant cell tumor of bone.
21057531 Inhibition of c-Met tyrosine kinase resulted in downregulation of TP53-induced TIGAR and depletion of intracellular NADPH and cell death.
21043826 Expressed in most neuroendocrine tumors of lung. Coexpression of PAX5 with c-Met or phosphorylated c-Met was present in most of the atypical carcinoids, SCLCs, and large cell neuroendocrine carcinomas.
20974860 study shows decorin blocks several biological activities mediated by Met signaling axis; these effects were mediated by downregulation of noncanonical beta-catenin levels; Myc was downregulated by decorin; phosphorylation of Myc at threonine 58 was induced
20949619 MET activating mutations are genetic markers associated with the Cancer of unknown primary origin (CUP) syndrome.
20949619 Observational study of gene-disease association. (HuGE Navigator)
20946682 c-Met inhibitors PHA-665752 and PF-2341066 have an anti-proliferative role in advanced prostate cancer
20937841 Allosteric peptide activators of pro-hepatocyte growth factor stimulate Met signaling.
20927591 CD151, c-Met, and integrin alpha3/alpha6 were all overexpressed in pancreatic ductal adenocarcinoma. CD151 and c-Met might be new molecular markers to predict the prognosis of pancreatic ductal adenocarcinoma patients.
20832323 recurrent glioblastoma multiforme express c-Met at a higher level and that c-Met overexpression is associated with shorter progression-free survival time in patients with glioblastoma multiforme.
20687930 Results identified Brk and ERK5 as important downstream effectors of Met signaling to cell migration.
20670955 Authors present an analysis of two sequence variants of the MET receptor (hepatocyte growth factor receptor) R970C and T992I (also designated R988C and T1010I).
20670955 Observational study of gene-disease association. (HuGE Navigator)
20661229 Results indicate that c-Met/HGF pathway may be a potential target for therapeutic intervention for treatment of EOC.
20661223 in colon cancer sprouty functions as an oncogene and its effects are mediated in part by c-Met upregulation
20639860 primary myxofibrosarcomas, MET overexpression associated with important prognosticators, and was independently predictive of worse outcomes
20617367 This study suggested that c-MET overexpression may represent an early chromosome 7 alteration that could play an important role during chordoma pathogenesis.
20615438 The results of this study provided further evidence for a possible role of MET in the pathogenesis of Autism Spectrum Disorders.
20615438 Observational study of gene-disease association. (HuGE Navigator)
20580899 Immunohistochemistry in muscle from polymyositis and dermatomyositis patients revealed that HGF was expressed predominantly on infiltrating mononuclear cells and that muscle cells expressed the receptor c-met.
20562909 demethylation of the colon carcinoma cell line HCT116 induces the expression of an illegitimate fusion transcript between an intronic LINE-1 element and the proto-oncogene cMet
20558345 simultaneous expression of HGF/c-met and three trasducers of tyrosine kinase receptors STAT3, PI3K, RHO in both nodular and extranodular tissues were studied by immunohistochemistry in 50 benign thyroid nodules, 25 associated with Hashimoto's thyroiditis
20545554 Human hepatocyte growth factor receptor is a cellular coreceptor for adeno-associated virus serotype 3
20529867 Dorsal ruffle microdomains potentiate Met receptor tyrosine kinase signaling and down-regulation
20529820 This study did not reveal any prognostic value of c-met or VEGF.
20514461 c-Met antisense oligonucleotides increase the sensitivity of human glioma to paclitaxel.
20512480 is overexpressed in chordomas
20489150 Data report that Met protein expression and phosphorylation were associated with primary resistance to EGFR TKI therapy in NSCLC patients harboring EGFR mutations, implicating Met as a de novo mechanism of resistance.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20421991 Hypomethylation of a LINE-1 promoter activates an alternate transcript of the MET oncogene in bladders with cancer
20416453 These data suggest that polymorphisms in the MET gene may play a role in the susceptibility to develop CRS. Study findings apply to patients with severe CRS unresponsive to surgery.
20416453 Observational study of gene-disease association. (HuGE Navigator)
20406949 MET activation as a cause of resistance to c-Src inhibition.
20370683 c-Met-specific small tyrosine kinase inhibitor SU11274 successfully inhibited primary tumor growth and liver colony formation by human melanoma cells in SCID mice.
20367286 The current study highlights the significance of HGF/c-Met signaling in the capacity of MSC to restore blood flow after an ischemic injury.
20338593 Our results indicated that the overexpression of c-Met gene played an important role in the progression and development of small cell lung cancer.
20331976 study found four gastric cancer cell lines harbored amplification of c-met locus, and among them, Hs746T had a putative oncogenic mutation with amplification
20331593 This immunohistochemical study is the first to document c-Met expression in human embryo minor salivary glands and to suggest the involvement of the c-Met/HGF system in their development
20237428 An overview of murine Met models in relation to the spectrum of mouse models of breast cancer and a role for the Met receptor in basal breast cancer tumorigenesis, is provided.
20200025 HGF and c-Met are widely expressed in pituitary adenomas and may have a role in their angiogenesis and tumorigenesis
20198821 Because enamel organ cells interact with mesenchymal cells directly, and c-Met is expressed in stages at which mesenchymal induction is guided by the dental epithelium, c-Met is related to tooth germ morphogenesis and cell differentiation.
20198305 These findings suggest aberrantly down-regulated hsa-miR-34c is a critical factor that contributes to malignancy in human laryngeal carcinoma by a mechanism involving targeting of c-Met.
20190195 We now report that monocytes' contact-dependent mitogenicity is controlled by activation-mediated regulation of hepatocyte growth factor
20178463 The cross-talk and balance between HGF/c-Met signal pathways are critical and necessary in the development of new therapies for lung cancer.
20164843 Plexin B1 may function as a tumor promoter in melanomas not driven by c-Met activation.
20164036 The MET receptor plays a very important role in facilitating metastasis of RMS cells, blocking of HGF-MET axis might be considered as a therapeutic option for RMS patients, at more advanced and metastatic stages.
20154724 EGFR signaling can regulate MET levels through HIF-1alpha and that MET is a key downstream mediator of EGFR-induced invasiveness in EGFR-dependent NSCLC cells.
20150826 Phosphorylation of MET and MET amplification is associated with lung adenocarcinoma.
20129249 MET activation by its ligand, HGF, also induces drug resistance
20126471 Inhibition of c-Met blocked the acquired anoikis resistance and restored chemosensitivity in three-dimensional not in two-dimensional ovarian cancer cell cultures
20107422 High MET gene copy number is associated with non-small cell lung cancer.
20085644 Activation of VEGF165-NRP1-c-MET signaling could confer prostate cancer (PCa) cells survival advantages by up-regulating Mcl-1, contributing to PCa progression.
20080979 evidence suggesting an intriguing relationship between cancer-related genes and schizophrenia susceptibility.
20080979 Observational study of gene-disease association. (HuGE Navigator)
20072648 Data show that PF-2341066 reduced HGF-stimulated phosphorylation of c-Met in the tyrosine kinase domain as well as phosphorylation of the downstream signaling effectors, Akt and Erks.
20067553 The MET promotes the melanoma cancer phenotype by promoting migration, invasion, resistance to apoptosis, and tumor cell growth.
20061986 Uveal melanomas express HGF, c-Met, EGFR, and IGF-1R
20042668 Stromal changes associated with breast cancer can control proto-oncogene function.
20021260 G-CSF-mediated hematopoietic stem/progenitor cells (HSPC) mobilization occurs in part through the HGF/c-Met axis in HSPC and myeloid cells, eliciting increased production of matrix-degrading enzymes and subsequently facilitating egress of HSPC.
20019837 Results provide evidence that autocrine overactivation of the Met- HGF loop enhances systemic metastases in NSCLC.
20011629 The purpose of this study was to determine if genetic variants in the hepatocyte growth factor receptor (MET) gene are associated with refractive error and ocular biometric measures in a Caucasian cohort.
20011629 Observational study of gene-disease association. (HuGE Navigator)
19940359 Data show that Plex-B1 assumes a predictive value for unfavourable outcome when co-expressed with Met.
19934279 Results show that SGX523 is the most selective inhibitor of MET catalytic activity described to date and is thus a useful tool to investigate the role of MET kinase in cancer without the confounding effects of promiscuous protein kinase inhibition.
19900460 the signaling-competent InlB-Met complex assembles with 2:2 stoichiometry around a back-to-back InlB dimer, enabling the direct contact between the stalk region of two Met molecules
19881549 we aimed to examine the significance of Src-mediated Gab1 phosphorylation in the hepatocyte growth factor (HGF) signaling
19877526 Liposomal quercetin could suppress the proliferation of culture Eca109/9706 cells by suppressing expression of c-met and VEGF.
19854350 Histopathology and expression of Met in cancer and its association with clinicopathological characteristics.
19834061 Results support a role for c-Met as an inhibitor of apoptosis and an activator of Bcl-xl.
19817696 Using lung adenocarcinoma samples and cell lines derived from lung adenocarcinomas, we demonstrated that the gene copy number for MET in lung adenocarcinoma tissue samples was increased over EGFR, HGF, and PXN and that it correlated with better prognosis
19812598 Observational study of gene-disease association. (HuGE Navigator)
19808904 Accordingly, the present study suggests that MET activation caused by factors other than MET gene amplification is not a suitable surrogate marker of resistance to EGFR-TKIs.
19773544 Data suggest that the coreceptor function of CD44v6 for c-Met and VEGFR-2 is a promising target to block angiogenesis in pathologic conditions.
19765730 Exploring the roles of c-met in modulating the motility of cell, by silencing c-met expression in a human hepatoma cell line.
19723643 The MET in lung cancer tissues contained nonsynonymous mutations in the semaphorin and juxtamembrane domains but not in the tyrosine kinase domain. East Asians, African-Americans, and Caucasians had different MET genotypes and haplotypes.
19723643 Observational study of gene-disease association. (HuGE Navigator)
19716155 EGFR, c-Met, and VEGFR1 involved in carcinogenesis are well-represented and coexpressed in anal cancers, especially in HIV-positive population
19713535 Report negative action of hepatocyte growth factor/c-Met system on angiotensin II signaling via ligand-dependent epithelial growth factor receptor degradation mechanism in vascular smooth muscle cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19681062 This study is the third independent study to find the rs1858830 C variant in the MET gene promoter to be associated with autism.
19681062 Observational study of gene-disease association. (HuGE Navigator)
19665015 Infection with H. pylori provokes shedding of the ectodomains of c-Met and E-cadherin. ADAM10 contributes to the shedding of c-Met and E-cadherin.
19651775 a model for a neoplastic pathway where expression of PAX6 from development activates the MET receptor
19639388 observed association between MET Y1253D-activating point mutation and decreased distant metastasis-free survival in advanced HNSCC suggests that MET may be a potential target for specific treatment interventions
19639388 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19638428 Critical role for HGF/Met signalling in promoting PGE(2) biogenesis in colorectal cancer cells.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19617568 Met induces mammary tumors with diverse histologies and is associated with poor outcome and human basal breast cancer.
19567831 MET may play a critical role in the development of the most aggressive breast cancers and may be a rational therapeutic target.
19556890 MACC1 acts via a specific consensus sequence of the Met promoter, described as an Sp1 binding site.
19549766 Urinary met may provide a noninvasive biomarker indicative of metastatic prostate cancer and may be a central regulator of multiple pathways involved in prostate cancer progression.
19548256 the MET C allele influences at least two of the three domains of the autism triad
19548256 Observational study of gene-disease association. (HuGE Navigator)
19546160 link between the PAR(2) and Met receptor tyrosine kinase signaling in promoting hepatocellular carcinoma (HCC) cell invasion.
19539981 Results demonstrated the presence of c-Met in osteogenic and chondrogenic tissues of developing human mandibles, which indicates possible functions for this receptor during mandibular development.
19502802 The downstream signaling in tumor cells overexpressing Met is not stably suppressed by Met tyrosine kinase inhibitors, even though Met remains fully inhibited.
19500853 Our data implicate the involvement of cMET in the pathogenesis of myopia in general, as well as more rapid progression in refractive error regardless of the initial refractory ability.
19500853 Observational study of gene-disease association. (HuGE Navigator)
19490101 Results show that overexpression of miR-23b leads to uPA and c-met downregulation and to decreased migration and proliferation abilities of HCC cells.
19483716 Data show that c-Met is the substrate of ST6Gal-I, and that the hyposialylation of c-Met can abolish cell motility in ST6Gal-I-KD HCT116 cells.
19472090 MET protein is found to be highly expressed in alveolar soft part sarcoma patients, most commonly in the lower extremity (thigh, lower leg, and foot).
19471602 Observational study of gene-disease association. (HuGE Navigator)
19470725 Results show that blocking the HGF/c-Met pathway may be clinically useful for the treatment of HNSCC.
19450681 An inverse relationship was found between generation of cytoplasmic fragment of MET protein and phosphorylation of MET protein, with a direct involvement of phosphorylated Tyrosine 1001 in protecting MET against its caspase cleavage.
19433454 Decorin suppresses intracellular levels of beta-catenin, a known downstream Met effector, and inhibits Met-mediated cell migration and growth
19432801 CD44v6 is required for InlB-induced c-Met activation in Listeria invasion.
19403030 HBx induces the expression of c-met through the activation of AP-2 and SP-1 activity at the promoter region in HepG2 cells.
19381876 EGFR T790M mutation and c-MET amplification can occur in tyrosine kinase inhibitor-resistant non-small cell lung cancer with wild-type EGFR. These genetic defects might be related to different survival outcome.
19380521 Combination of MET and EGFR inhibitors triggered stronger inhibition on cell proliferation and invasion of MPM cells than that of each in vitro.
19360663 data further support our hypothesis that genetic susceptibility impacting multiple components of the MET signaling pathway contributes to autism spectrum disorder risk
19359592 HGF-induced activation of the Met receptor results in TF expression by MB cells and that this event probably contribute to tumor proliferation by enabling the formation of a provisional fibrin matrix.
19357348 The constitutive activation of nuclear Met-signaling pathway in MDA-MB231 cells, possibly determined at genetic or epigenetic levels of WWOX gene, might participate in breast carcinoma progression influencing invasive/metastatic phenotype.
19353596 Observational study of gene-disease association. (HuGE Navigator)
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19321255 SMYD3 has a role in regulation of c-Met expression and in cell migration and invasion induced by HGF
19318497 the relatively infrequent expression of HGF and Met in Wilms' tumor tumorigenesis reflects their roles in nephrogenesis, particularly the mesenchymal-to-epithelial transition, rather than a dependence on oncogenic signaling pathways.
19302530 c-MET expression was observed in most spinal chordomas and correlated with the expression of CAM5.2, suggesting a relationship to an epithelial phenotype.
19297528 Met is processed in epithelial cells by presenilin-dependent regulated intramembrane proteolysis (PS-RIP) independently of ligand stimulation.
19255323 MET increased gene copy number is an independent negative prognostic factor in surgically resected non-small-cell lung cancer
19255034 These results suggest that disrupted MET signaling may contribute to increased risk for autism spectrum disorder that includes familial gastrointestinal dysfunction.
19255034 Observational study of gene-disease association. (HuGE Navigator)
19220894 C-met has a role in endometrial receptivity through its interaction with Plexin B1.
19190120 PTEN loss amplifies c-Met-induced glioblastoma malignancy.
19186126 molecular mechanism of activation and the functional role of cancer mutations in altering protein kinase structure, dynamics, and stability.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165419 Expression of c-Met can be inhibited by RNA interference in flioma cells, which can inhibit the growth and metastasis of glioma cells and induce cell apoptosis.
19151767 MET as a target of YB-1 that work in concert to promote Basal-like breast cancers (BLBC) growth.
19139719 study determined PAX5 could regulate transcription of c-Met; the phospho-c-Met (active form) & PAX5 were both localized to the same intra-nuclear compartment in hepatocyte growth factor treated small-cell lung cancer cells and interacted with each other
19126036 Lack of oncogenic mutations in the c-Met catalytic tyrosine kinase domain in acral lentiginous melanoma
19121849 c-Met plays an important role in bladder cancer development
19118941 NmU may be involved in the HGF-c-Met paracrine loop regulating cell migration, invasiveness and dissemination of pancreatic ductal adenocarcinoma.
19117057 MET amplification is present in untreated NSCLC and EGFR mutation or MET amplification activates MET protein in NSCLC
19109251 Distinct recruitment of Eps15 via Its coiled-coil domain is required for efficient down-regulation of the met receptor tyrosine kinase.
19107227 Ret/ptc1 cross talks with Met at transcriptional and signaling levels and promotes beta-catenin transcriptional activity to drive thyrocyte neoplastic transformation.
19100682 MET receptor tyrosine kinase is a therapeutic anticancer target [review]
19096301 Observational study of gene-disease association. (HuGE Navigator)
19096300 Activation of MET by gene amplification or by splice mutations deleting the juxtamembrane domain is associated with primary resected lung cancers.
19074879 This work identifies three miRNAs that negatively regulate MET expression. Inhibition of these endogenous miRNAs, by use of antagomiRs, resulted in increased expression of MET protein.
19065669 The combination of CD151/c-Met is a novel marker in predicting the prognosis of hepatocellular carcinoma and a potential therapeutic target.
19050584 Perinuclear translocation of c-Met is confirmed in hepatocyte growth factor-stimulated cells; the increase in size of the 50 kDa subunit of c-Met may indicate the involvement of the [alpha]-chain in c-Met intracellular trafficking in chordoma cells.
19037978 a critical role of Met gene dose in non-small cell lung cancer , suggesting that Met may be a specific molecular therapeutic target in selected non-small cell lung cancer patients with increased Met copy number.
19006648 miR-34a has a role in tumor migration and invasion through modulation of the c-Met signaling pathway
19002214 our findings provide further evidence that MET may play a role in autism susceptibility.
19002214 Observational study of gene-disease association. (HuGE Navigator)
18992144 c-Met kinase activity can up-regulate death receptor expression and thereby sensitize tumor cells to the death receptor ligand TRAIL
18990695 ability of the leucine-rich repeat fragment to promote Met recycling could account for the increased cell motility induced by this ligand
18973760 Steric hindrance of the interaction between HGF beta domain binding to Met is sufficient for inhibiting full-length HGF-dependent Met signaling and cell migration.
18938767 The epithelial expression of HGFR is elevated in mildly active UC.
18930356 TFE3-renal carcinoma in an adult patient: a case with strong expression of phosphorylated hepatocyte growth factor (HGFR)/Met.
18839537 The abnormal expression of c-met and PCNA protein was related with the oncogenesis of gastric carcinoma.
18836087 MET increased gene copy number and primary resistance to gefitnib therapy in non-small-cell lung cancer patients are reported.
18819921 PTP1B and TCPTP play distinct and non-redundant roles in the regulation of the Met receptor-tyrosine kinase
18813782 HGF and c-Met have roles in growth of aggressive adult T-cell leukemia/lymphoma cells
18779368 STAT3 activation and nuclear accumulation in response to Hepatocyte Growth Factor requires nuclear-proximal activated c-Met.
18709663 Mutations in the nonkinase regions of MET might play an important role in tumorigenesis and tumor progression.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636147 germline c-met missense mutation g.3522G--> A in exon 16 and somatic missense mutation g.3997 T-->C in exon 19 were identified in papillary renal cell carcinoma patients identified
18628476 a novel splice variant of the Met receptor, Cgen-241A, is a potent antagonist of the hepatocyte growth factor/scatter factor-Met pathway
18628208 the HGF/c-MET axis has a role in guiding stem cells toward brain injury
18625714 Phosphorylation of MUC1 by Met modulates interaction with p53 and MMP1 expression.(
18593989 CXCR4 and c-Met are widely expressed in rhabdomyosarcoma and, at higher levels, in isolated marrow-infiltrating tumor cells
18578997 Disruption of lipid rafts inhibits the activation of PLCr1/PKC and PI3K/PKB signaling pathways by c-Met.
18564920 identification of HGF/MET mutations in primary lymphedema, lymphedema/lymphangiectasia, and breast cancer-associated secondary lymphedema suggests that the HGF/MET pathway is causal or alters susceptibility for a broad range of lymphedema phenotypes
18559601 The relative subcellular distribution of Met may be a valuable biomarker for estimating colon cancer prognosis.
18504429 Met-driven invasive growth involves transcriptional regulation of Arhgap12.
18497953 overexpression of c-met is associated with gastric carcinoma
18497076 Amplification of MET is associated with type I endometrial carcinoma tumors
18495663 analysis of the hepatocyte growth factor-binding site in the immunoglobulin-like region of Met
18471412 High glucose can induce the expression of c-met, and Radix Astragali can up-regulate the expressions of c-met mRNA and protein in human kidney fibroblasts.
18456660 the MET proto-oncogene and the downstream extracellular signal-regulated kinase 2 (ERK2) are regulated by MicroRNA miR-199a*
18451162 Usefulness of Frzb in modulating Met signaling as a new treatment strategy for soft tissue sarcomas.
18451158 A Met/c-Src-mediated signaling pathway is a mediator of EGFR tyrosine phosphorylation and cell growth in the presence of EGFR tyrosine kinase inhibitors.
18395971 c-Met gene amplification is linked to metastatic progression, and is a viable target for a significant subset of advanced CRC.
18379349 MET amplification associated with EGFR amplification is associated with non-small cell lung cancer
18316611 Met receptor contributes to trastuzumab resistance of Her2-overexpressing breast cancer cells
18291418 NK1 variants have no detectable agonistic activity on, behave as bona fide receptor antagonists by blocking cell migration and DNA synthesis in target cells and have strong prospects as therapeutics for human cancer.
18273647 Report renal expression of alpha-smooth muscle actin and c-Met in children with Henoch-Schonlein purpura nephritis.
18272501 a previously uncharacterized GM2/GM3 heterodimer complexed with CD82 inhibits cell motility through CD82-cMet or integrin-cMet pathway
18258742 Src family kinases activity is important for the growth of colorectal cancer cell lines, although only low activity levels are required
18192688 Selectivity for specific adaptor protein involvement may be the key that determines the tissue- and cell-type specificity of Met-mediated tumorigenicity in human cancers
18187039 p100 MET, corresponding to the entire extracellular region of the MET receptor still spanning the membrane is able to bind HGF/SF and to prevent HGF-dependent signaling downstream of full MET, demonstrating its function as a decoy receptor.
18180459 oncogenic EGFR and c-Met have roles in pathways mediating drug response
18172343 The expression rate of c-met was higher in adenocarcinomas than adenomas.
18159174 The expression of c-met was closely related to the invasiveness of cholangiocarcinoma.
18093943 MET amplification occurs independently of EGFR(T790M) mutations in lung adenocarcinoma
18063891 HGF/c-Met were expressed in serum-starved ARPE-19 cells.
18059365 cooperative role for c-Met and c-Myc in large-cell anaplastic medulloblastoma formation
18053801 These results demonstrated that VPA inhibited two critical processes of tumor-stromal interaction, induction of fibroblastic HGF production and HGF-induced invasion of HepG2 cells.
18025083 a novel mechanism by which plexin-mediated signaling can be regulated and explains how Sema4D can exert different biological activities through the differential association of its receptor with ErbB-2 and Met.
18024311 Co-expression of HGF and c-Met in gastric cancer may promote the progression of gastric cancer.
17992475 This study was designed to investigate the roles of HGF/c-Met in tumor progression and metastasis in HepG2 and Hep3B hepatoma cell lines
17981731 HGF and c-MET are potential orchestrators of invasive growth in head and neck squamous cell carcinoma [review]
17804715 The tumor suppressor activity of GPx3 seems to relate to its ability to suppress the expression of c-met.
17704785 Fas antagonism by Met is abrogated in human fatty liver disease.
17702746 CD44 is an important regulator of HGF/c-Met-mediated in vitro and in vivo barrier enhancement, a process with essential involvement of Tiam1, Rac1, dynamin 2, and cortactin.
17696172 Altered expression of MET and related molecules suggests dysregulation of signaling that may contribute to altered circuit formation and function in autism spectrum disorder
17689924 These results demonstrate that lysophosphatidic acid regulates c-Met function through PKC delta and E-cadherin.
17684486 persistent expression of the MET oncogene is mandatory until the advanced phases of cancer progression.
17673463 c-MET is associated with FAS and when activated enhances drug-induced apoptosis in pediatric B acute lymphoblastic leukemia with TEL-AML1 translocation
17662939 The crystal structure of the complex between a large fragment of the human Met ectodomain and the Met-binding domain of InlB.
17611703 c-met is an essential factor in the processes of migration and invasion of hepatocarcinoma cells
17593080 Imbalance in c-Met expression between tumour and surrounding normal tissue is associated with aggressive ductal carcinoma in situ phenotype. c-Met and HGF/SF may contribute to tumour development by different means than those controlled by Her2/neu.
17463250 findings show that amplification of MET causes gefitinib resistance in lung cancer by driving ERBB3 (HER3)-dependent activation of PI3K, a pathway thought to be specific to EGFR/ERBB family receptors
17459054 In lung adenocarcinoma, c-Met activation may take place either ligand-dependently or ligand-independently via c-Met. overexpression.
17372204 although serine proteases and HGF have quite distinct functions in proteolysis and Met signal transduction, respectively, they share a similar activation mechanism
17332337 Met is necessary for lung cancer cell lines growth and survival.
17322284 HGF stimulation of c-Met-overexpressing H69 small cell lung cancer cells (40 ng/ml, 15 min) resulted in an increase of reactive oxygen species
17243166 Plays a role in the progression of rhabdomyosarcoma.
17215249 glycosphingolipids, particularly GM2, form a complex with CD82, and this complex interacts with Met and thereby inhibits HGF-induced Met tyrosine kinase activity, as well as integrin to Met cross-talk
17132227 c-Met has a role in progression of esophageal adenocarcinoma
17079873 The alternatively-spliced form of MET may contribute to the development and progression of human cancer.
17062664 Met activation induces changes consistent with early invasion, such as down-regulation of E-cadherin and anchorage-independent growth of esophageal adenocarcinoma.
17062641 Serum-independent growth of 5637 cells involves the transmembrane signaling cascade via EGFR ligand(s) (but not HGF), EGFR, Src and p145(met).
17053076 Observational study of gene-disease association. (HuGE Navigator)
17053076 genetic association (P = 0.0005) of a common C allele in the promoter region of the MET gene in 204 autism families
16953230 A functional crosstalk between hepatocyte growth factor receptor (MET) and beta-catenin signaling sustains and increases colorectal carcinoma cell invasive properties.
16951184 Mimp expression reduces hepatocyte growth factor/scatter factor-induced proliferation and scattering by attenuating and altering the downstream signaling of met proto-oncogene.
16912172 Processing of the Met receptor results in the release of the cytoplasmic domain and its translocation to the nucleus in cells at low density.
16891453 IGF-IR and c-Met cooperate to induce migration and invasion of human pancreatic carcinoma cells.
16870139 results suggest that activation of c-Met signaling in prostate cancer cells may lead to induction of spontaneous mutations or genomic instability, which may lead to progression of androgen-independent state
16867270 c-met-siRNA can down-regulate the expression of c-met and inhibit hepatocellular carcinoma cell proliferation, motility and invasiveness.
16857786 c-Met ectodomain shedding has a role in cancer's malignant potential
16804974 Overexpression of c-met occurs during the early stage of pancreatic carcinogenesis, and a single alteration of c-met expression is not sufficient for progression of chronic pancreatitis-affected epithelial cells to pancreatic cancer cells.
16710476 Results reveal that a subset of human hepatocellular carcinomas and all liver metastases shared the Met-induced expression signature.
16709175 As discussed in this review, receptor tyrosine kinase Met and its ligand HGF/SF (hepatocyte growth factor/scatter factor) are essential in the signalling pathways required for embryogenesis and tissue regeneration.
16627020 Liver cancer patients had a significantly higher level of serum hepatocyte growth factor than normal controls
16547140 Antibodies efficiently down-regulates HGF receptor through a molecular mechanism involving a double proteolytic cleavage
16537444 crystal structure, at 2.15-A resolution, of the autoinhibited form of the kinase domain, revealing an intricate network of interactions involving c-Met residues
16498238 The consistent expression of HGF and c-met during the perinatal period supports a physiological role for HGF in human lung development.
16455654 c-Met expression is regulated by Mitf in the melanocyte lineage
16426920 study showed that c-Met overexpression may be important for the progression of cervical adenocarcinomas
16403482 using RT-PCR for the detection of c-Met or mucin 1 mRNA may be a promising tool for the early detection of micro-metastatic circulating tumor cells in gastric carcinoma patients
16278380 XIAP expression in colorectal cancer is regulated by hepatocyte growth factor/C-met pathway via Akt signaling
16216128 expression of hepatocyte and keratinocyte growth factors and their receptors is preserved in patients with lung emphysema as compared to patients without emphysema
16192631 HGFR signaling mediates the anti-fibrotic action of alitretinoin in glomerular mesangial cells.
16186806 upregulation of the MET pathway may contribute to the poor outcome of esophageal adenocarcinoma patients and that therapeutic agents targeting this pathway may help improve patient survival
16158056 hepatocyte growth factor signaling and Ki-ras oncogene activation have roles in colorectal cancer
16139245 These results suggest that CD151 forms a structural and functional complex with c-Met and integrin alpha3/alpha6, and exerts its oncogenic functions through excessive activation of the HGF/c-Met signalling pathway.
16099863 Induction of Met expression by low-oxygen tension may play an important role in the physiology of early pregnancy by promoting the invasion of trophoblast cells into the decidua of the uterus.
16039997 It is concluded that level and duration of MAPK activation by Met receptor are crucial for the induction of a full HGF-dependent mitogenic and invasive program in KS cells.
15980634 Deregulation of the interaction between HGF and its receptor c-met during placentation may be the cause responsible for the growth retardation of the fetus due to the impaired placental functions.
15911745 cMet/Fas interaction may inhibit self-association of Fas receptor such that reduced DISC formation occurs in these cells after Fas receptor ligation. cMet/Fas interaction may help explain why endothelial cells are resistant to Fas-mediated apoptosis.
15870272 negative feedback regulation in which Met activation leads to transcriptional induction of Notch function, which in turn limits HGF activity through repression of the Met oncogene
15849510 IGF-I and HGF cooperate to induce migration and invasion of colorectal carcinoma cells, and c-Met and uPA/uPAR are required for IGF-I-mediated migration and invasion.
15828871 Analysis with phospho-specific antibodies indicates that 3 kinases generate a signal-specific, combinatorial phosphorylation profile of the Hrs-STAM complex, with the potential of diversifying tyrosine kinase receptor signalling through a common element.
15772665 Targeting the activated, human MET oncogene to adult mouse liver caused slowly progressing hepatocarcinogenesis
15760460 HGF/MET signalling protects Plasmodium sporozoite-infected host cells from apoptosis.
15720819 c-Met is overexpressed in esophageal adenocarcinoma.
15717924 Through promoting Met-Integrin association, HGF-FN and HGF-VN complexes coordinated and enhanced endothelial cell migration through activation of the PI-3 kinase pathway involving a Ras-dependent mechanism
15678502 Cell proliferation, invasion, and morphological characteristics may be induced independently from the HGF/SF-Met pathway in C31/Tag metastatic prostate cancer cells.
15672865 overexpression of c-Met is associated with advanced stage colorectal cancer
15659325 in chronic skin ulcers, decreased biological activity of endogenous HGF and overexpression of c-met may have roles in fibrosis and delayed recovery
15632204 demonstrate that Sema4D is angiogenic in vitro and in vivo and that this effect is mediated by its high-affinity receptor, Plexin B1, and that biologic effects elicited by Plexin B1 require coupling and activation of the Met tyrosine kinase
15596854 role of coreceptor for adeno-associated virus type 2 (AAV2) infection by facilitating AAV2 internalization into the cytoplasm
15590419 The role of HGFR signal in colon tumorigenesis is associated to progression of adenoma into carcinoma.
15579033 mutated in papillary renal cell carcinoma.
15516982 findings expand our understanding of tumor promoter/suppressor inter-relationships and downstream transcriptional effects of PTEN loss and c-Met overexpression in malignant gliomas
15504247 These results indicate that c-Met is actually activated in gastric carcinoma tissue, and may trigger proliferation/anti-apoptotic signals.
15492846 The autocrine mechanism between over-expressed c-Met and HGF/SF in malignant tumors is part of the process of pleural metastatic spread.
15466866 K48R-linked polyubiquitin is required for Met endosomal trafficking
15448002 Met proto-oncogene and insulin-like growth factor binding protein 3 have roles in metastasis of well-differentiated pancreatic endocrine neoplasms
15339794 TGF-beta1 significantly induced c-met expression in human kidney cells, which primarily took place at the gene transcriptional level.
15327888 Review. The role of Met in normal human prostate epithelium, and underlying mechanisms of deregulated Met expression in localized and metastatic prostate cancer are discussed.
15314156 Results suggest that MUC20 is a novel regulator of the Met signaling cascade which has a role in suppression of the Grb2-Ras pathway.
15302591 Compared to IOSE-29, IOSE-Ov29 and IOSE-Ov29/T4 exhibited higher levels of the HGF receptor Met and an increasing duration of ERK1/2 activation with malignant progression, in conjunction with other neoplastic properties.
15287857 HGF-specific immunostaining of proliferating cholangioles in the absence of HGF RNA suggests c-Met-mediated uptake of HGF and paracrine stimulation of cholangiocellular proliferation
15254691 Stat3 mediated by c-Met is frequently associated with the progression of oral squamous cell carcinoma
15192042 Met is frequently activated in these carcinomas and may favor tumor growth, and abundance of Met expression may differently regulate cell growth, morphogenesis, and migration in response to HGF.
15184888 MET receptor can interact with each of the three members of class B Plexins and control tumor invasive growth.
15173072 c-Met oncogene is a novel tumor rejection antigen recognized by cytotoxic T-lymphocytes and expressed on a broad variety of epithelial and hematopoietic malignant cells
15161909 the invasive function of Met can be independent of alpha(6)beta(4); alpha(6)beta(4) has a generic influence on the invasion of carcinoma cells that is not specific to Met
15123705 Results provide an explanation for cell surface receptor cross-talk involving the Met receptor and link G protein-coupled receptors and the epidermal growth factor receptor to the oncogenic potential of Met signaling in human carcinoma cells.
15123609 Data identify a DpYR motif including tyrosine(1003) as being important for the direct recruitment of the c-Cbl tyrosine kinase binding domain and for ubiquitination of the Met receptor.
15075332 Ser-985 phosphorylation of c-Met is bi-directionally regulated through PKC and PP2A
14719064 Differentially expressed in gastric cancer and intestinal metaplasia.
14627992 Mutation present in a notable subset of patients with oropharyngeal cancer and may interfere with radioresponsiveness.
14528000 establish by deletion mutagenesis that the HGF/SF and heparin-binding sites of MET are contained within a large N-terminal domain spanning the alpha-chain (amino acids 25-307) and the first 212 amino acids of the beta-chain (amino acids 308-519)
14524531 c-Met and HGF-SF have roles in the growth and progression of human and canine osteosarcoma
14519655 Retroviral ribozyme transgenes targeting HGF/SF in fibroblasts or its receptor cMET in mammary cancer cells can reduce the growth of mammary cancer and associated angiogenesis by inhibiting paracrine stromal-tumor cell interactions.
14509156 MUC1 and Met can be detected in the axillary fluids of patients with breast cancer; the expression of both tumor markers in the axillary drainage is strongly associated with unfavorable tumor features and can be used as a prognostic factor
14508824 C-met expression is a significant marker for tall cell variant papillary carcinoma of the thyroid gland.
12915129 These data suggest that coexpression of the MET and RON receptors confer a selective advantage to ovarian cancer cells and might promote ovarian cancer progression.
12884908 c-Met signaling has roles in scattering, angiogenesis, proliferation, enhanced cell motility, invasion, and eventual metastasis [review]
12883672 hepatocyte growth factor and c-Met/HGF receptor have roles in prostate neoplasm progression
12856716 Activation of c-Met in colorectal carcinoma cells leads to constitutive association of tyrosine-phosphorylated beta-catenin
12847110 N-terminal domain of HGF inhibits angiogenesis not by disrupting the HGF/c-met interaction but rather by interfering with the endothelial glycosaminoglycans.
12793903 Met can be detected in the axillary fluids of patients who undergo conservative operations for breast cancer, and its expression in the axillary drainage may have potential as a prognostic factor.
12766170 Gab1 and the Met receptor interact in a novel manner, such that the activated kinase domain of Met and the negative charge of phosphotyrosine 1349 engage the Gab1 MBD as an extended peptide ligand
12726861 hypoxia promotes tumor invasion by sensitizing cells to hepatocyte growth factor stimulation, providing a molecular basis to explain Met overexpression in cancer
12716900 data define a protein kinase c-controlled traffic pathway for c-Met that operates independently of its degradative pathway
12709413 Role of the HGF receptor in proliferation and invasive behavior of osteosarcoma cell lines.
12707786 Autocrine and paracrine support of HGF-c-Met system attenuates degeneration of anterior horn cells in amyotrophic lateral sclerosis. Disruption of neuronal HGF-c-Met system at advanced stage accelerates cellular degeneration and cell death.
12686592 Endosomal dynamics of Met determine signaling output.
12682635 Met is expressed by the majority of MM cell lines and by approximately half of the primary plasma cell neoplasms tested.The hepatocyte growth factor/Met pathway controls proliferation and apoptosis in multiple myeloma.
12651912 Ki-ras mutations and HGF signaling cooperate to enhance tumor growth by increased duration of MAPK activation and decreased apoptosis in human carcinoma cells.
12646256 These results indicate that overexpression of hepatocyte growth factor receptor tyrosine kinase in renal carcinoma cells participates in rapid tumor growth in vivo.
12611639 Activation of the c-Met pathway targets the PI3K pathway in small cell lung cancer
12595309 up-regulated during the in vitro recapitulation of several steps of angiogenesis; expression increased shortly after switching to angiogenic growth conditions & remained high during the first steps of angiogenesis, including cell migration & proliferation
12594808 Radiation stimulates HGF receptor/c-Met expression that leads to amplifying cellular response to HGF stimulation via upregulated receptor tyrosine phosphorylation and MAP kinase activity in pancreatic cancer cells.
12538453 HGF may have a role in the pathogenesis of papillary thyroid carcinoma
12524084 immunoexpression of hepatocyte growth factor and c-Met in the eutopic endometrium of patients with pelvic endometrioisis is possibly useful to predict greater activity of the ectopic endometrium
12460923 MET may be one of the long sought oncogenes controlling progression of primary cancers to metastasis.
12244174 MET signaling is negatively regulated by c-Cbl which induces ubiquitination of its cytoplasmic domain.
12233882 Overexpression of HGF/c-met appears to be a biological feedback response to the fibrotic process of systemic sclerosis.
12183053 a signal transduction cascade or cross-talk emanating from CD44 to c-Met
12168776 HGF and HGFR have an alternative role activating the via STAT3 transdution and operating on placental tissues, overall in organogenesis alteration conditions
11948964 high expression seen in intermediate cells in normal and malignant prostate epithelium indicates they are prone to stromal invasion in prostate carcinoma
11895493 Increased c-Met expression participates in cholangiocarcinogenesis and in the early developmental stages of intrahepatic cholangiocarcinoma.
11894096 The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met
11864613 Met sequesters Fas, preventing apoptosis.
11839685 Modulation of the c-Met/hepatocyte growth factor pathway in small cell lung cancer
11750879 Role of the hepatocyte growth factor receptor, c-Met, in oncogenesis and potential for therapeutic inhibition

AA Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI      1 - 70
YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT     71 - 140
CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP    141 - 210
LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR    211 - 280
FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK    281 - 350
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF    351 - 420
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV    421 - 490
IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI    491 - 560
CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM    561 - 630
NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK    631 - 700
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV    701 - 770
SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV    771 - 840
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE    841 - 910
WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL    911 - 980
DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT    981 - 1050
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE   1051 - 1120
VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK   1121 - 1190
GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF   1191 - 1260
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF   1261 - 1330
SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS             1331 - 1390
//

Text Mined References (881)

PMID Year Title
27094128 2016 Live cell imaging shows hepatocyte growth factor-induced Met dimerization.
27069297 2016 Diagnosis and Prognostic Significance of c-Met in Cervical Cancer: A Meta-Analysis.
27055285 2016 The Association between EGFR and cMET Expression and Phosphorylation and Its Prognostic Implication in Patients with Breast Cancer.
27030755 2016 Insulin-Independent GABAA Receptor-Mediated Response in the Barrel Cortex of Mice with Impaired Met Activity.
26934743 2016 Pre-Osteoblasts Stimulate Migration of Breast Cancer Cells via the HGF/MET Pathway.
26905592 2016 Regulation of the MET oncogene: molecular mechanisms.
26845230 2016 Oncogene swap as a novel mechanism of acquired resistance to epidermal growth factor receptor-tyrosine kinase inhibitor in lung cancer.
26823824 2015 C-MET overexpression and amplification in gliomas.
26801760 2016 Novel c-Met inhibitor suppresses the growth of c-Met-addicted gastric cancer cells.
26791796 2015 MET amplification, protein expression, and mutations in pulmonary adenocarcinoma.
26791795 2015 Predictive and prognostic value of de novo MET expression in patients with advanced non-small-cell lung cancer.
26790028 2016 Elevated hepatocyte growth factor expression as an autocrine c-Met activation mechanism in acquired resistance to sorafenib in hepatocellular carcinoma cells.
26772959 2016 M10, a caspase cleavage product of the hepatocyte growth factor receptor, interacts with Smad2 and demonstrates antifibrotic properties in vitro and in vivo.
26729443 2016 MET Exon 14 Mutations in Non-Small-Cell Lung Cancer Are Associated With Advanced Age and Stage-Dependent MET Genomic Amplification and c-Met Overexpression.
26719224 2016 Increased MACC1 expression indicates a poor prognosis independent of MET expression in gastric adenocarcinoma.
26700818 2016 PKC? activated by c-MET enhances infiltration of human glioblastoma cells through NOTCH2 signaling.
26637977 2015 Mutations Preventing Regulated Exon Skipping in MET Cause Osteofibrous Dysplasia.
26636767 2015 Relationships between Chromosome 7 Gain, MET Gene Copy Number Increase and MET Protein Overexpression in Chinese Papillary Renal Cell Carcinoma Patients.
26581482 2015 Focused molecular analysis of small cell lung cancer: feasibility in routine clinical practice.
26580964 2015 MET Gene Amplification and MET Receptor Activation Are Not Sufficient to Predict Efficacy of Combined MET and EGFR Inhibitors in EGFR TKI-Resistant NSCLC Cells.
26543351 2015 Overexpression of PI3K p110? contributes to acquired resistance to MET inhibitor, in MET-amplified SNU-5 gastric xenografts.
26543230 2015 Isothiocyanatostilbenes as novel c-Met inhibitors.
26505625 2016 Validation and genomic interrogation of the MET variant rs11762213 as a predictor of adverse outcomes in clear cell renal cell carcinoma.
26497851 2015 Hsa-miR-139-5p inhibits proliferation and causes apoptosis associated with down-regulation of c-Met.
26496879 2015 DCIS in BRCA1 and BRCA2 mutation carriers: prevalence, phenotype, and expression of oncodrivers C-MET and HER3.
26472163 2015 Heterogeneity of c-Met expression in Chinese gastric cancer patients.
26459369 2015 c-MET immunostaining in colorectal carcinoma is associated with local disease recurrence.
26448928 2015 MET Expression in Primary and Metastatic Clear Cell Renal Cell Carcinoma: Implications of Correlative Biomarker Assessment to MET Pathway Inhibitors.
26436697 2015 c-Met inhibitors attenuate tumor growth of small cell hypercalcemic ovarian carcinoma (SCCOHT) populations.
26408683 2015 Reversal of c-MET-mediated Resistance to Cytotoxic Anticancer Drugs by a Novel c-MET Inhibitor TAS-115.
26402720 2015 MiRNAs associated polymorphisms in the 3'UTR of MET promote the risk of non-small cell lung cancer.
26395411 2016 Alterations of MET Gene Copy Number and Protein Expression in Primary Non-Small-Cell Lung Cancer and Corresponding Nodal Metastases.
26384300 2015 Constitutive activation of MET signaling impairs myogenic differentiation of rhabdomyosarcoma and promotes its development and progression.
26375439 2015 Gastrointestinal malignancies harbor actionable MET exon 14 deletions.
26351321 2015 Inhibition of ABCB1 Overcomes Cancer Stem Cell-like Properties and Acquired Resistance to MET Inhibitors in Non-Small Cell Lung Cancer.
26351320 2015 Targeting FGFR Pathway in Human Hepatocellular Carcinoma: Expressing pFGFR and pMET for Antitumor Activity.
26345996 2015 Met tyrosine kinase inhibitor, PF-2341066, suppresses growth and invasion of nasopharyngeal carcinoma.
26334097 2015 Deregulation of ARID1A, CDH1, cMET and PIK3CA and target-related microRNA expression in gastric cancer.
26330547 2015 Tumor MET Expression and Gene Amplification in Chinese Patients with Locally Advanced or Metastatic Gastric or Gastroesophageal Junction Cancer.
26325180 2015 Down-regulation of c-Met and Bcl2 by microRNA-206, activates apoptosis, and inhibits tumor cell proliferation, migration and colony formation.
26319934 2015 Activation of MET pathway predicts poor outcome to cetuximab in patients with recurrent or metastatic head and neck cancer.
26310485 2015 YangZheng XiaoJi exerts anti-tumour growth effects by antagonising the effects of HGF and its receptor, cMET, in human lung cancer cells.
26301867 2015 Mechanism of Resistance and Novel Targets Mediating Resistance to EGFR and c-Met Tyrosine Kinase Inhibitors in Non-Small Cell Lung Cancer.
26299665 2016 MicroRNA-31 inhibits lung adenocarcinoma stem-like cells via down-regulation of MET-PI3K-Akt signaling pathway.
26282167 2015 Hepatocyte Growth Factor/cMET Pathway Activation Enhances Cancer Hallmarks in Adrenocortical Carcinoma.
26238632 2015 Tyrosylprotein sulfotransferase 1 expression is negatively correlated with c?Met and lymph node metastasis in human lung cancer.
26229399 2015 Association of hepatocyte-derived growth factor receptor/caudal type homeobox 2 co-expression with mucosal regeneration in active ulcerative colitis.
26227486 2015 Met Signaling Cascade Is Amplified by the Recruitment of Phosphorylated Met to Lipid Rafts via CD24 and Leads to Drug Resistance in Endometrial Cancer Cell Lines.
26225770 2015 The c-MET Network as Novel Prognostic Marker for Predicting Bladder Cancer Patients with an Increased Risk of Developing Aggressive Disease.
26216473 2015 Identification of Tyrosine-Phosphorylated Proteins Upregulated during Epithelial-Mesenchymal Transition Induced with TGF-?.
26215952 2016 Next-Generation Sequencing of Pulmonary Sarcomatoid Carcinoma Reveals High Frequency of Actionable MET Gene Mutations.
26210452 2015 Signal transduction and downregulation of C-MET in HGF stimulated low and highly metastatic human osteosarcoma cells.
26189249 2015 c-Met and RON expression levels in endometrial adenocarcinoma tissue and their relationship with prognosis.
26186594 2015 MicroRNA-206: Effective Inhibition of Gastric Cancer Progression through the c-Met Pathway.
26184032 2015 MicroRNA-200a Targets EGFR and c-Met to Inhibit Migration, Invasion, and Gefitinib Resistance in Non-Small Cell Lung Cancer.
26165838 2016 Deregulated hepsin protease activity confers oncogenicity by concomitantly augmenting HGF/MET signalling and disrupting epithelial cohesion.
26159851 2015 Clinical and prognostic value of MET gene copy number gain and chromosome 7 polysomy in primary colorectal cancer patients.
26155941 2015 A first-in-human study of AMG 208, an oral MET inhibitor, in adult patients with advanced solid tumors.
26143374 2015 Identification of the receptor tyrosine kinases (RTKs)-oriented functional targets of miR-206 by an antibody-based protein array.
26141862 2015 Depleting MET-Expressing Tumor Cells by ADCC Provides a Therapeutic Advantage over Inhibiting HGF/MET Signaling.
26137585 2015 MET Suppresses Epithelial VEGFR2 via Intracrine VEGF-induced Endoplasmic Reticulum-associated Degradation.
26115870 2015 Ginsenoside-Rg1 induces angiogenesis by the inverse regulation of MET tyrosine kinase receptor expression through miR-23a.
26108200 2015 c-Met identifies a population of matrix metalloproteinase 9-producing monocytes in peritumoural stroma of hepatocellular carcinoma.
26104764 2015 The expression of microRNA-34a is inversely correlated with c-MET and CDK6 and has a prognostic significance in lung adenocarcinoma patients.
26097553 2015 HGF/MET signaling promotes glioma growth via up-regulation of Cox-2 expression and PGE2 production.
26075299 2015 Comprehensive gene and microRNA expression profiling reveals miR-206 inhibits MET in lung cancer metastasis.
26068448 2015 Potential Role of Soluble c-Met as a New Candidate Biomarker of Metastatic Uveal Melanoma.
26047809 2015 Prognostic significance of c-Met in breast cancer: a meta-analysis of 6010 cases.
26044563 2015 Regulation of MET-mediated proliferation of thyroid carcinoma cells by miR-449b.
26041880 2015 MET expression and copy number heterogeneity in nonsquamous non-small cell lung cancer (nsNSCLC).
26026086 2015 ROCK I Has More Accurate Prognostic Value than MET in Predicting Patient Survival in Colorectal Cancer.
26013381 2015 Activating MET kinase rearrangements in melanoma and Spitz tumours.
26009992 2015 Molecular characterization of patients with pathologic complete response or early failure after neoadjuvant chemotherapy for locally advanced breast cancer using next generation sequencing and nCounter assay.
26006023 2015 The hepatocyte growth factor receptor as a potential therapeutic target for dedifferentiated liposarcoma.
26000960 2015 Regulation of metastatic ability and drug resistance in pulmonary adenocarcinoma by matrix rigidity via activating c-Met and EGFR.
25996296 2015 Necrosis- and apoptosis-related Met cleavages have divergent functional consequences.
25987653 2015 Gene of the month: MET.
25985180 2015 MET is required for the recruitment of anti-tumoural neutrophils.
25971938 2015 Activation of MET via diverse exon 14 splicing alterations occurs in multiple tumor types and confers clinical sensitivity to MET inhibitors.
25965822 2015 Prognostic value of MET protein overexpression and gene amplification in locoregionally advanced nasopharyngeal carcinoma.
25961751 2015 MiR-144 Inhibits Uveal Melanoma Cell Proliferation and Invasion by Regulating c-Met Expression.
25945949 2016 An intramolecular G-quadruplex structure formed in the human MET promoter region and its biological relevance.
25941349 2015 A mutation of MET, encoding hepatocyte growth factor receptor, is associated with human DFNB97 hearing loss.
25940797 2015 Thyroid hormone-mediated regulation of lipocalin 2 through the Met/FAK pathway in liver cancer.
25938344 2015 Correlation between MET protein expression and MET gene copy number in a Caucasian cohort of non-small cell lung cancers according to the new IASLC/ATS/ERS classification.
25935522 2015 Enhanced expression and phosphorylation of the MET oncoprotein by glioma-specific PTPRZ1-MET fusions.
25927670 2015 MicroRNA-144 inhibits the metastasis of gastric cancer by targeting MET expression.
25923130 2015 Analysis and significance of c-MET expression in adenoid cystic carcinoma of the salivary gland.
25916750 2015 Insulin-like growth factor-1 receptor is associated with better prognosis in classical Hodgkin's lymphoma: Correlation with MET expression.
25908454 2015 Knockdown of c-MET induced apoptosis in ABCB1-overexpressed multidrug-resistance cancer cell lines.
25888626 2015 MET receptor is a potential therapeutic target in high grade cervical cancer.
25886066 2015 MET FISH-positive status predicts short progression-free survival and overall survival after gefitinib treatment in lung adenocarcinoma with EGFR mutation.
25880599 2015 miR-454 is down-regulated in osteosarcomas and suppresses cell proliferation and invasion by directly targeting c-Met.
25875173 2015 YKL-40/c-Met expression in rectal cancer biopsies predicts tumor regression following neoadjuvant chemoradiotherapy: a multi-institutional study.
25874496 2015 MicroRNA-1 (miR-1) inhibits gastric cancer cell proliferation and migration by targeting MET.
25874493 2015 MET is a predictive factor for late recurrence but not for overall survival of early stage hepatocellular carcinoma.
25869878 2015 Coexpression of c-Met and Notch-1 correlates with poor prognosis in resected non-small-cell lung cancer.
25868389 2015 Identification of new biomarkers for human papillary thyroid carcinoma employing NanoString analysis.
25862637 2015 Identification of a novel MET mutation in high-grade glioma resulting in an auto-active intracellular protein.
25847631 2015 Evaluation of tyrosine kinase receptors in brain metastases of clear cell renal cell carcinoma reveals cMet as a negative prognostic factor.
25844809 2015 MET gene copy number alterations and expression of MET and hepatocyte growth factor are potential biomarkers in angiosarcomas and undifferentiated pleomorphic sarcomas.
25834821 2015 Soluble c-Met is a reliable and sensitive marker to detect c-Met expression level in lung cancer.
25834339 2015 Prognostic value of c-Met in colorectal cancer: a meta-analysis.
25831463 2015 Endothelial PAS domain-containing protein 1 confers TKI-resistance by mediating EGFR and MET pathways in non-small cell lung cancer cells.
25820598 2015 The prognostic impact of EGFR, ErbB2 and MET gene amplification in human gastric carcinomas as measured by quantitative Real-Time PCR.
25816892 2015 Adaptor protein CRK induces epithelial-mesenchymal transition and metastasis of bladder cancer cells through HGF/c-Met feedback loop.
25782598 2015 Maxillary carcinosarcoma: Identification of a novel MET mutation in both carcinomatous and sarcomatous components through next generation sequencing.
25775951 2015 Stromal cells of endometrial carcinoma promotes proliferation of epithelial cells through the HGF/c-Met/Akt signaling pathway.
25768032 2014 Highlights in NSCLC from the 2014 American Society of Clinical Oncology annual meeting.
25746038 2015 High-throughput oncogene mutation profiling shows demographic differences in BRAF mutation rates among melanoma patients.
25660117 2015 MACC1 suppresses cell apoptosis in hepatocellular carcinoma by targeting the HGF/c-MET/AKT pathway.
25658794 2015 Expression and significance of CD44, CD47 and c-met in ovarian clear cell carcinoma.
25653235 2015 Activation of PAX3-MET pathways due to miR-206 loss promotes gastric cancer metastasis.
25647613 2016 LoVo colon cancer cells resistant to oxaliplatin overexpress c-MET and VEGFR-1 and respond to VEGF with dephosphorylation of c-MET.
25645920 2015 Novel roles of c-Met in the survival of renal cancer cells through the regulation of HO-1 and PD-L1 expression.
25636446 2015 High c-Met expression is a negative prognostic marker for colorectal cancer: a meta-analysis.
25633810 2015 MicroRNA-93 activates c-Met/PI3K/Akt pathway activity in hepatocellular carcinoma by directly inhibiting PTEN and CDKN1A.
25620570 2015 Damnacanthal, a noni anthraquinone, inhibits c-Met and is a potent antitumor compound against Hep G2 human hepatocellular carcinoma cells.
25611392 2015 MiR-34c suppresses tumor growth and metastasis in nasopharyngeal carcinoma by targeting MET.
25605252 2015 Functional consequence of the MET-T1010I polymorphism in breast cancer.
25592281 2015 Clinical significance of hepatocyte growth factor/c-Met expression in the assessment of gastric cancer progression.
25588551 2015 Expression and clinical significance of c-Met in advanced esophageal squamous cell carcinoma.
25586241 2015 Prognostic Value of Hepatocyte Growth Factor Receptor Expression in Patients with Perihilar Cholangiocarcinoma.
25584489 2015 Exposure-response analysis of rilotumumab in gastric cancer: the role of tumour MET expression.
25565142 2015 Epigenetic regulation of the lncRNA MEG3 and its target c-MET in pancreatic neuroendocrine tumors.
25541150 2015 Biological properties of ligand-dependent activation of the MET receptor kinase in acute myeloid leukemia.
25531327 2015 PAX3 and ETS1 synergistically activate MET expression in melanoma cells.
25522678 2015 Tumor-suppressive microRNA-206 as a dual inhibitor of MET and EGFR oncogenic signaling in lung squamous cell carcinoma.
25504327 2015 Expression of hepatocyte growth factor and c-Met in non-small-cell lung cancer and association with lymphangiogenesis.
25502629 2015 Activated MET acts as a salvage signal after treatment with alectinib, a selective ALK inhibitor, in ALK-positive non-small cell lung cancer.
25499462 2015 AKT and MET signalling mediates antiapoptotic radioresistance in head neck cancer cell lines.
25492484 2015 MiR-335 inhibits migration of breast cancer cells through targeting oncoprotein c-Met.
25492085 2015 MET amplification status in therapy-naïve adeno- and squamous cell carcinomas of the lung.
25489726 2015 Quantification of serum MET in non-small-cell lung cancer and its clinical significance.
25482018 2015 Ovarian cancer ascites enhance the migration of patient-derived peritoneal mesothelial cells via cMet pathway through HGF-dependent and -independent mechanisms.
25471370 2015 A novel isoform of met receptor tyrosine kinase blocks hepatocyte growth factor/Met signaling and stimulates skeletal muscle cell differentiation.
25457019 2015 Response to crizotinib in a patient with MET-mutant papillary renal cell cancer after progression on tivantinib.
25453846 2014 Gene mutations in small-cell lung cancer (SCLC): results of a panel of 6 genes in a cohort of Italian patients.
25427200 2014 c-Met targeting enhances the effect of irradiation and chemical agents against malignant colon cells harboring a KRAS mutation.
25425645 2015 The DNA replication licensing factor miniature chromosome maintenance 7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor.
25416047 2014 Single-nucleotide polymorphism rs41736 located in MET was significantly associated with prognosis of small cell lung cancer patients.
25405368 2015 Dual regulation of receptor tyrosine kinase genes EGFR and c-Met by the tumor-suppressive microRNA-23b/27b cluster in bladder cancer.
25400108 2015 Essential role of Her3 in two signaling transduction patterns: Her2/Her3 and MET/Her3 in proliferation of human gastric cancer.
25381262 2015 Identifying actionable targets through integrative analyses of GEM model and human prostate cancer genomic profiling.
25364819 2014 Analysis of MET mRNA expression in gastric cancers using RNA in situ hybridization assay: its clinical implication and comparison with immunohistochemistry and silver in situ hybridization.
25341359 2014 A putative pH-dependent nuclear localization signal in the juxtamembrane region of c-Met.
25335552 2014 Preliminary evaluation of urinary soluble Met as a biomarker for urothelial carcinoma of the bladder.
25326232 2014 Analysis of 1,115 patients tested for MET amplification and therapy response in the MD Anderson Phase I Clinic.
25323095 2015 Immunohistochemical expression of receptor tyrosine kinase PDGFR-?, c-Met, and EGFR in skull base chordoma.
25320014 2014 Targeting the c-Met/FZD8 signaling axis eliminates patient-derived cancer stem-like cells in head and neck squamous carcinomas.
25314059 2014 Clinical massively parallel next-generation sequencing analysis of 409 cancer-related genes for mutations and copy number variations in solid tumours.
25310337 2014 SB365, Pulsatilla saponin D, suppresses the growth of gefitinib-resistant NSCLC cells with Met amplification.
25306394 2015 TNF-? promotes invasive growth through the MET signaling pathway.
25305631 2014 MET, a driver of invasive growth and cancer clonal evolution under therapeutic pressure.
25278243 2014 MicroRNA-409-3p functions as a tumor suppressor in human lung adenocarcinoma by targeting c-Met.
25248999 2015 Volitinib, a potent and highly selective c-Met inhibitor, effectively blocks c-Met signaling and growth in c-MET amplified gastric cancer patient-derived tumor xenograft models.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25230070 2014 Co-expression of MET and CD47 is a novel prognosticator for survival of luminal breast cancer patients.
25226813 2015 Tivantinib (ARQ 197) efficacy is independent of MET inhibition in non-small-cell lung cancer cell lines.
25220207 2014 Tumor budding in colorectal carcinoma assessed by cytokeratin immunostaining and budding areas: possible involvement of c-Met.
25212607 2014 A HGF/cMET autocrine loop is operative in multiple myeloma bone marrow endothelial cells and may represent a novel therapeutic target.
25211165 2014 c-MET expression in primary and liver metastases in uveal melanoma.
25203738 2014 Prognostic impact of the c-MET polymorphism on the clinical outcome in locoregional gastric cancer patients.
25200159 2014 [Construction and application of a lentiviral vector of single-chain variable fragment antibody against human hepatocyte growth factor receptor].
25194039 2014 MET T992I mutation in a case of ependymoblastoma/embryonal tumour with multilayered rosettes.
25187556 2014 Direct regulation of GAS6/AXL signaling by HIF promotes renal metastasis through SRC and MET.
25186085 2015 Matriptase and MET are prominently expressed at the site of bone metastasis in renal cell carcinoma: immunohistochemical analysis.
25148256 2014 Reciprocal activating crosstalk between c-Met and caveolin 1 promotes invasive phenotype in hepatocellular carcinoma.
25135958 2014 RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas.
25109336 2015 GD3 synthase regulates epithelial-mesenchymal transition and metastasis in breast cancer.
25099011 2014 Crosstalk between nuclear MET and SOX9/?-catenin correlates with castration-resistant prostate cancer.
25090459 2014 Activated cMET and IGF1R-driven PI3K signaling predicts poor survival in colorectal cancers independent of KRAS mutational status.
25087088 2015 MET abnormalities in patients with genitourinary malignancies and outcomes with c-MET inhibitors.
25084805 2014 cMET in triple-negative breast cancer: is it a therapeutic target for this subset of breast cancer patients?
25074413 2014 PAK1 mediates pancreatic cancer cell migration and resistance to MET inhibition.
25065564 2014 Analysis of MET genetic aberrations in patients with breast cancer at MD Anderson Phase I unit.
25058462 2014 MiR-181a-5p is downregulated in hepatocellular carcinoma and suppresses motility, invasion and branching-morphogenesis by directly targeting c-Met.
24983965 2014 Absolute quantitation of Met using mass spectrometry for clinical application: assay precision, stability, and correlation with MET gene amplification in FFPE tumor tissue.
24973425 2014 Functional genetic approach identifies MET, HER3, IGF1R, INSR pathways as determinants of lapatinib unresponsiveness in HER2-positive gastric cancer.
24952592 2014 HGF/c-Met axis drives cancer aggressiveness in the neo-adjuvant setting of ovarian cancer.
24947080 2014 Biochemical and immunomorphological evaluation of hepatocyte growth factor and c-Met pathway in patients with critical limb ischemia.
24922520 2014 Prognostic value of MET gene copy number and protein expression in patients with surgically resected non-small cell lung cancer: a meta-analysis of published literatures.
24916572 2014 Anti-tumor activity of oridonin on SNU-5 subcutaneous xenograft model via regulation of c-Met pathway.
24913906 2015 Study of MET protein levels and MET gene copy number in 72 sinonasal intestinal-type adenocarcinomas.
24911613 2014 IndividualizedPath: identifying genetic alterations contributing to the dysfunctional pathways in glioblastoma individuals.
24901400 2014 High incidence of ErbB3, ErbB4, and MET expression in ovarian cancer.
24865428 2014 Four individually druggable MET hotspots mediate HGF-driven tumor progression.
24863535 2014 Clinical impact of c-MET expression and genetic mutational status in colorectal cancer patients after liver resection.
24853099 2014 Reduced membranous MET expression is linked to bladder cancer progression.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24837198 2014 MicroRNA-34A inhibits the growth, invasion and metastasis of gastric cancer by targeting PDGFR and MET expression.
24835487 2014 Receptor tyrosine kinase c-Met controls the cytoskeleton from different endosomes via different pathways.
24828152 2014 USP8 modulates ubiquitination of LRIG1 for Met degradation.
24827412 2014 Significance of c-MET overexpression in cytotoxic anticancer drug-resistant small-cell lung cancer cells.
24823486 2014 Activation of c-Met and upregulation of CD44 expression are associated with the metastatic phenotype in the colorectal cancer liver metastasis model.
24814316 2014 Tensin-4-dependent MET stabilization is essential for survival and proliferation in carcinoma cells.
24814255 2014 MET expression is associated with disease-specific survival in breast cancer patients in the neoadjuvant setting.
24810547 2014 Frequent hepatocyte growth factor overexpression and low frequency of c-Met gene amplification in human papillomavirus-negative tonsillar squamous cell carcinoma and their prognostic significances.
24810336 2014 miR-199a-3p displays tumor suppressor functions in papillary thyroid carcinoma.
24804300 2014 MET amplification is not rare and predicts unfavorable clinical outcomes in patients with recurrent/metastatic gastric cancer after chemotherapy.
24802404 2014 MET inhibitor PHA-665752 suppresses the hepatocyte growth factor-induced cell proliferation and radioresistance in nasopharyngeal carcinoma cells.
24790222 2014 Distinct c-Met activation mechanisms induce cell rounding or invasion through pathways involving integrins, RhoA and HIP1.
24786972 2014 Biological, diagnostic and therapeutic relevance of the MET receptor signaling in head and neck cancer.
24777602 2014 The Pim-1 protein kinase is an important regulator of MET receptor tyrosine kinase levels and signaling.
24766640 2014 Evaluation of MYOC, ACAN, HGF, and MET as candidate genes for high myopia in a Han Chinese population.
24743740 2014 Agonist antibodies activating the Met receptor protect cardiomyoblasts from cobalt chloride-induced apoptosis and autophagy.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722154 2014 High MET receptor expression but not gene amplification in ALK 2p23 rearrangement positive non-small-cell lung cancer.
24714091 2014 Cetuximab-induced MET activation acts as a novel resistance mechanism in colon cancer cells.
24710956 2014 FN14 expression correlates with MET in NSCLC and promotes MET-driven cell invasion.
24708867 2014 Met receptor-induced Grb2 or Shc signals both promote transformation of intestinal epithelial cells, albeit they are required for distinct oncogenic functions.
24687921 2014 Biomarker analyses from a placebo-controlled phase II study evaluating erlotinib┬▒onartuzumab in advanced non-small cell lung cancer: MET expression levels are predictive of patient benefit.
24658158 2014 MET is a potential target across all papillary renal cell carcinomas: result from a large molecular study of pRCC with CGH array and matching gene expression array.
24634221 2014 Role of c-Met/phosphatidylinositol 3-kinase (PI3k)/Akt signaling in hepatocyte growth factor (HGF)-mediated lamellipodia formation, reactive oxygen species (ROS) generation, and motility of lung endothelial cells.
24628993 2014 Role of PAX8 in the regulation of MET and RON receptor tyrosine kinases in non-small cell lung cancer.
24626858 2015 Expression profiles of HER2, EGFR, MET and FGFR2 in a large cohort of patients with gastric adenocarcinoma.
24621885 2014 MicroRNA-608 and microRNA-34a regulate chordoma malignancy by targeting EGFR, Bcl-xL and MET.
24615768 2014 MET is a potential target for use in combination therapy with EGFR inhibition in triple-negative/basal-like breast cancer.
24609899 2014 miR-199a-3p inhibits hepatocyte growth factor/c-Met signaling in renal cancer carcinoma.
24596364 2014 Low protein expression of MET in ER-positive and HER2-positive breast cancer.
24567328 2014 Activated platelets interfere with recruitment of mesenchymal stem cells to apoptotic cardiac cells via high mobility group box 1/Toll-like receptor 4-mediated down-regulation of hepatocyte growth factor receptor MET.
24565853 2014 Overexpression of CMET is associated with signal transducer and activator of transcription 3 activation and diminished prognosis in oesophageal adenocarcinoma but not in squamous cell carcinoma.
24562934 2014 Upregulation of HGF and c-MET is associated with subclinical central lymph node metastasis in papillary thyroid microcarcinoma.
24518603 2014 HER2, MET and FGFR2 oncogenic driver alterations define distinct molecular segments for targeted therapies in gastric carcinoma.
24510991 2014 Expression of PDGFR-?, EGFR and c-MET in spinal chordoma: a series of 52 patients.
24478054 2014 RANK- and c-Met-mediated signal network promotes prostate cancer metastatic colonization.
24465403 2014 MET genetic abnormalities unreliable for patient selection for therapeutic intervention in oropharyngeal squamous cell carcinoma.
24448239 2014 MET signaling in colon cancer stem-like cells blunts the therapeutic response to EGFR inhibitors.
24444253 2014 Down-regulation of MET in hippocampal neurons of Alzheimer's disease brains.
24440758 2014 Met endosomal signalling: in the right place, at the right time.
24440350 2014 Targeting of the MET receptor tyrosine kinase by small molecule inhibitors leads to MET accumulation by impairing the receptor downregulation.
24416238 2014 Prognostic significance of MET amplification and expression in gastric cancer: a systematic review with meta-analysis.
24393368 2014 Expressions and clinical significances of c-MET, p-MET and E2f-1 in human gastric carcinoma.
24390087 2014 Sustained endoplasmic reticulum stress inhibits hepatocyte proliferation via downregulation of c-Met expression.
24389444 2013 Lung adenocarcinoma patient refractory to gefitinib and responsive to crizotinib, with concurrent rare mutation of the epidermal growth factor receptor (L861Q) and increased ALK/MET/ROS1 gene copy number.
24389243 2014 An 'in-cell trial' to assess the efficacy of a monovalent anti-MET antibody as monotherapy and in association with standard cytotoxics.
24386407 2013 Ability of the Met kinase inhibitor crizotinib and new generation EGFR inhibitors to overcome resistance to EGFR inhibitors.
24354242 2013 [Increased expression of the c-Met receptor mRNA in gastric cancer].
24327519 2014 Combined MET inhibition and topoisomerase I inhibition block cell growth of small cell lung cancer.
24326984 2014 Cytokeratin 5/6, c-Met expressions, and PTEN loss prognostic indicators in triple-negative breast cancer.
24324260 2014 Overexpression of c-Met and CD44v6 receptors contributes to autocrine TGF-?1 signaling in interstitial lung disease.
24306956 2014 FGFR2, HER2 and cMet in gastric adenocarcinoma: detection, prognostic significance and assessment of downstream pathway activation.
24300717 2014 Increased c-Met phosphorylation is related to keloid pathogenesis: implications for the biological behaviour of keloid fibroblasts.
24290385 2013 MET receptor tyrosine kinase as an autism genetic risk factor.
24285539 2014 Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells.
24284055 2014 Targeting epithelial-to-mesenchymal transition with Met inhibitors reverts chemoresistance in small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24259426 2014 MicroRNA-26a suppresses angiogenesis in human hepatocellular carcinoma by targeting hepatocyte growth factor-cMet pathway.
24258345 2014 Nonclinical evaluation of the serum pharmacodynamic biomarkers HGF and shed MET following dosing with the anti-MET monovalent monoclonal antibody onartuzumab.
24240654 2014 Autism spectrum disorder: interaction of air pollution with the MET receptor tyrosine kinase gene.
24223894 2013 C-Met as a prognostic marker in gastric cancer: a systematic review and meta-analysis.
24222167 2013 A survey of c-MET expression and amplification in 287 patients with hepatocellular carcinoma.
24212721 2014 MET gene copy number gain is an independent poor prognostic marker in Korean stage I lung adenocarcinomas.
24200637 Low frequency KRAS mutations in colorectal cancer patients and the presence of multiple mutations in oncogenic drivers in non-small cell lung cancer patients.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24170771 2014 Off-target effects of c-MET inhibitors on thyroid cancer cells.
24167634 2013 Gefitinib inhibits invasive phenotype and epithelial-mesenchymal transition in drug-resistant NSCLC cells with MET amplification.
24150964 2014 C-Met in invasive breast cancer: is there a relationship with the basal-like subtype?
24136235 2013 Caspase-generated fragment of the Met receptor favors apoptosis via the intrinsic pathway independently of its tyrosine kinase activity.
24124150 2013 MACC1 is related to colorectal cancer initiation and early-stage invasive growth.
24122846 2014 Novel Death Defying Domain in Met entraps the active site of caspase-3 and blocks apoptosis in hepatocytes.
24122793 2013 Increased TGF-? as a mechanism of acquired resistance to the anti-EGFR inhibitor cetuximab through EGFR-MET interaction and activation of MET signaling in colon cancer cells.
24118504 2013 Paracrine activation of MET promotes peritoneal carcinomatosis in scirrhous gastric cancer.
24115218 2014 Inhibition of EGFR induces a c-MET-driven stem cell population in glioblastoma.
24114941 2014 Leukocyte cell-derived chemotaxin 2 antagonizes MET receptor activation to suppress hepatocellular carcinoma vascular invasion by protein tyrosine phosphatase 1B recruitment.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24094902 2013 Association of c-Met phosphorylation with micropapillary pattern and small cluster invasion in pT1-size lung adenocarcinoma.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
24016866 2013 Decorin inhibits angiogenic potential of choroid-retinal endothelial cells by downregulating hypoxia-induced Met, Rac1, HIF-1? and VEGF expression in cocultured retinal pigment epithelial cells.
23992325 2014 MET as a potential target for the treatment of upper gastrointestinal cancers: characterization of novel c-Met inhibitors from bench to bedside.
23973484 2013 6-Phosphogluconate dehydrogenase regulates tumor cell migration in vitro by regulating receptor tyrosine kinase c-Met.
23944359 2014 Regulation of MET receptor signaling by SOCS1 and its implications for hepatocellular carcinoma.
23922103 2013 The tumour suppressor miR-34c targets MET in prostate cancer cells.
23919423 2013 Analysis of EGFR, EML4-ALK, KRAS, and c-MET mutations in Chinese lung adenocarcinoma patients.
23898085 2013 c-MET and HGF mRNA expression in hepatocellular carcinoma: correlation with clinicopathological features and survival.
23882082 2013 Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.
23877345 2013 From AR to c-Met: androgen deprivation leads to a signaling pathway switch in prostate cancer cells.
23873272 2013 Met, IGF1R, and other new targets in upper GI malignancies.
23867513 Targeting the hepatocyte growth factor/c-Met signaling pathway in renal cell carcinoma.
23866081 2013 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23861540 2013 Receptor tyrosine kinases fall into distinct classes based on their inferred signaling networks.
23841470 2013 The impact of genomic changes on treatment of lung cancer.
23825050 2013 MET and ERBB2 are coexpressed in ERBB2+ breast cancer and contribute to innate resistance.
23820886 2013 MicroRNA-409-3p inhibits migration and invasion of bladder cancer cells via targeting c-Met.
23812675 2013 Prognostic value and clinical pathology of MACC-1 and c-MET expression in gastric carcinoma.
23807774 2013 MET overexpression assessed by new interpretation method predicts gene amplification and poor survival in advanced gastric carcinomas.
23802768 2013 Impact of MET expression on outcome in BRAF(V600E/K) advanced melanoma.
23801885 2013 Lack of association of C-Met-N375S sequence variant with lung cancer susceptibility and prognosis.
23799130 2013 Expression of ST3GAL4 leads to SLe(x) expression and induces c-Met activation and an invasive phenotype in gastric carcinoma cells.
23792586 2013 A common p53 mutation (R175H) activates c-Met receptor tyrosine kinase to enhance tumor cell invasion.
23746173 2013 ADAM10/17-dependent release of soluble c-Met correlates with hepatocellular damage.
23745832 2013 Receptor tyrosine kinases MET and RON as prognostic factors in diffuse large B-cell lymphoma patients receiving R-CHOP.
23740136 2014 The immunohistochemical expression of c-Met is an independent predictor of survival in patients with glioblastoma multiforme.
23734217 2013 MicroRNA-449a is downregulated in non-small cell lung cancer and inhibits migration and invasion by targeting c-Met.
23695554 2013 The MET oncogene in glioblastoma stem cells: implications as a diagnostic marker and a therapeutic target.
23677180 2013 Dual inhibition of EGFR and c-Met kinase activation by MJ-56 reduces metastasis of HT29 human colorectal cancer cells.
23671132 2013 SB365, Pulsatilla saponin D, targets c-Met and exerts antiangiogenic and antitumor activities.
23665680 2014 Met-induced membrane blebbing leads to amoeboid cell motility and invasion.
23659968 2013 ETS2 mediated tumor suppressive function and MET oncogene inhibition in human non-small cell lung cancer.
23650389 2013 Cross-talk between MET and EGFR in non-small cell lung cancer involves miR-27a and Sprouty2.
23648337 2013 AXL and MET crosstalk to promote gonadotropin releasing hormone (GnRH) neuronal cell migration and survival.
23625089 2013 Gene silencing of c-Met leads to brain metastasis inhibitory effects.
23618864 2013 MicroRNA-101 suppresses motility of bladder cancer cells by targeting c-Met.
23583448 2013 WKYMVm-induced cross-talk between FPR2 and HGF receptor in human prostate epithelial cell line PNT1A.
23558571 2013 MET and MST1R as prognostic factors for classical Hodgkin's lymphoma.
23548264 2013 A novel inhibitor of c-Met and VEGF receptor tyrosine kinases with a broad spectrum of in vivo antitumor activities.
23546020 2013 Expression of receptor tyrosine kinases in esophageal carcinosarcoma.
23536000 2013 Study of critical role of c-Met and its inhibitor SU11274 in colorectal carcinoma.
23532910 2013 Expression of HGF and Met in human tissues of colorectal cancers: biological and clinical implications for synchronous liver metastasis.
23526299 2013 Ligand-independent activation of MET through IGF-1/IGF-1R signaling.
23520442 2013 Alterations in EGFR and related genes following neo-adjuvant chemotherapy in Chinese patients with non-small cell lung cancer.
23490239 2013 C-MET is expressed in the majority of penile squamous cell carcinomas and correlates with polysomy-7 but is not associated with MET oncogene amplification, pertinent histopathologic parameters, or with cancer-specific survival.
23470965 2013 Analysis of tumor specimens at the time of acquired resistance to EGFR-TKI therapy in 155 patients with EGFR-mutant lung cancers.
23469222 2013 Met is the most frequently amplified gene in endometriosis-associated ovarian clear cell adenocarcinoma and correlates with worsened prognosis.
23467907 2013 A novel c-Met inhibitor, MK8033, synergizes with carboplatin plus paclitaxel to inhibit ovarian cancer cell growth.
23456500 2013 MYO5B is epigenetically silenced and associated with MET signaling in human gastric cancer.
23449277 2013 MET and EGFR mutations identified in ALK-rearranged pulmonary adenocarcinoma: molecular analysis of 25 ALK-positive cases.
23431957 2013 Hepatocyte growth factor pathway upregulation in the bone marrow microenvironment in multiple myeloma is associated with lytic bone disease.
23410046 2013 Shedding of c-Met ectodomain correlates with c-Met expression in non-small cell lung cancer.
23386689 2013 Hepatocyte growth factor sensitizes brain tumors to c-MET kinase inhibition.
23381625 2013 Radiosensitization of brain metastasis by targeting c-MET.
23379953 2013 High MET gene copy number predicted poor prognosis in primary intestinal diffuse large B-cell lymphoma.
23360489 2013 Sorting nexin 2-mediated membrane trafficking of c-Met contributes to sensitivity of molecular-targeted drugs.
23359207 2013 Regulation of HGF expression by ?EGFR-mediated c-Met activation in glioblastoma cells.
23354516 2013 Microarray analysis of gene expression in vestibular schwannomas reveals SPP1/MET signaling pathway and androgen receptor deregulation.
23348694 2013 KRC-408, a novel c-Met inhibitor, suppresses cell proliferation and angiogenesis of gastric cancer.
23335077 2013 Expression and clinical relevance of MET and ALK in Ewing sarcomas.
23327903 2013 MET amplification as a potential therapeutic target in gastric cancer.
23327059 2012 Overexpression of c-Met in cervical intraepithelial neoplasia.
23320110 2013 HGF and c-Met interaction promotes migration in human chondrosarcoma cells.
23314853 2013 NK4 gene therapy inhibits HGF/Met-induced growth of human cholangiocarcinoma cells.
23314612 2013 MicroRNA-34b functions as a tumor suppressor and acts as a nodal point in the feedback loop with Met.
23296269 2013 HGF-MET cascade, a key target for inhibiting cancer metastasis: the impact of NK4 discovery on cancer biology and therapeutics.
23288161 2013 Rhodocetin-??-induced neuropilin-1-cMet association triggers restructuring of matrix contacts in endothelial cells.
23258844 2013 Wnt/?-catenin signaling is a key downstream mediator of MET signaling in glioblastoma stem cells.
23243217 2013 Detection of miR-34a promoter methylation in combination with elevated expression of c-Met and ?-catenin predicts distant metastasis of colon cancer.
23242174 2013 Aberrations of MET are associated with copy number gain of EGFR and loss of PTEN and predict poor outcome in patients with salivary gland cancer.
23219378 2013 Single nucleotide polymorphisms and risk of recurrence of renal-cell carcinoma: a cohort study.
23212923 2013 Critical role of S1PR1 and integrin ?4 in HGF/c-Met-mediated increases in vascular integrity.
23208509 2014 Cbl-independent degradation of Met: ways to avoid agonism of bivalent Met-targeting antibody.
23193156 2012 MUC1 drives c-Met-dependent migration and scattering.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23123275 2013 Structural basis of MET receptor dimerization by the bacterial invasion protein InlB and the HGF/SF splice variant NK1.
23097380 2012 Autism risk gene MET variation and cortical thickness in typically developing children and adolescents.
23094709 2013 Associations of VEGF/VEGF-receptor and HGF/c-Met promoter polymorphisms with progression/regression of retinopathy of prematurity.
23060267 2013 c-Met function requires N-linked glycosylation modification of pro-Met.
23049908 2012 Met kinetic signature derived from the response to HGF/SF in a cellular model predicts breast cancer patient survival.
23028720 2012 Met receptor acts uniquely for survival and morphogenesis of EGFR-dependent normal mammary epithelial and cancer cells.
23024367 2012 The tyrosine kinase c-Met contributes to the pro-tumorigenic function of the p38 kinase in human bile duct cholangiocarcinoma cells.
23022995 2013 c-Met is a prognostic marker and potential therapeutic target in clear cell renal cell carcinoma.
23006961 2012 Des-?-carboxy prothrombin and c-Met were concurrently and extensively expressed in hepatocellular carcinoma and associated with tumor recurrence.
23001699 2013 Soluble c-Met protein as a susceptible biomarker for gastric cancer risk: A nested case-control study within the Korean Multicenter Cancer Cohort.
22996389 2013 Dissociation of c-Met phosphotyrosine sites in human cells in response to mouse hepatocyte growth factor but not human hepatocyte growth factor: the possible roles of different amino acids in different species.
22976495 2012 Expression of the c-Met proto-oncogene and Integrin ?5?1 in human gastric cardia adenocarcinoma.
22973954 2013 Detection and therapeutic implications of c-Met mutations in small cell lung cancer and neuroendocrine tumors.
22962849 2012 Cooperative interaction of MUC1 with the HGF/c-Met pathway during hepatocarcinogenesis.
22958829 2012 Autism-associated promoter variant in MET impacts functional and structural brain networks.
22915589 2012 Anti-apoptotic role of caspase-cleaved GAB1 adaptor protein in hepatocyte growth factor/scatter factor-MET receptor protein signaling.
22897854 2012 Targeted disruption of heparan sulfate interaction with hepatocyte and vascular endothelial growth factors blocks normal and oncogenic signaling.
22890162 2012 Overexpression of hepatocyte growth factor receptor in scleroderma dermal fibroblasts is caused by autocrine transforming growth factor ? signaling.
22887347 2012 Engineered variants of InlB with an additional leucine-rich repeat discriminate between physiologically relevant and packing contacts in crystal structures of the InlB:MET complex.
22850551 2012 Increased MET and HGF gene copy numbers are associated with trastuzumab failure in HER2-positive metastatic breast cancer.
22833194 2011 Association of a MET genetic variant with autism-associated maternal autoantibodies to fetal brain proteins and cytokine expression.
22815748 2012 Met receptor tyrosine kinase signaling induces secretion of the angiogenic chemokine interleukin-8/CXCL8 in pancreatic cancer.
22814258 2012 [Prognostic value of MACC1 and c-met expressions in non-small cell lung cancer].
22789536 2012 VEGF inhibits tumor cell invasion and mesenchymal transition through a MET/VEGFR2 complex.
22750473 2012 MiR-410 regulates MET to influence the proliferation and invasion of glioma.
22738909 2012 The MET oncogene is a functional marker of a glioblastoma stem cell subtype.
22733437 2013 FAK, CD44v6, c-Met and EGFR in colorectal cancer parameters: tumour progression, metastasis, patient survival and receptor crosstalk.
22717761 2012 Novel germline c-MET mutation in a family with hereditary papillary renal carcinoma.
22704061 2012 Overexpression of c-Met promotes invasion and metastasis of small oral tongue carcinoma.
22689693 2012 Self-control of HGF regulation on human trophoblast cell invasion via enhancing c-Met receptor shedding by ADAM10 and ADAM17.
22683780 2012 Autocrine activation of the MET receptor tyrosine kinase in acute myeloid leukemia.
22672415 2013 MET gain in diffuse astrocytomas is associated with poorer outcome.
22660439 2012 ATM and MET kinases are synthetic lethal with nongenotoxic activation of p53.
22644302 2012 MET in gastric carcinomas: comparison between protein expression and gene copy number and impact on clinical outcome.
22640970 2012 The clinicopathologic association of c-MET overexpression in Iranian gastric carcinomas; an immunohistochemical study of tissue microarrays.
22635005 2012 Melanoma exosomes educate bone marrow progenitor cells toward a pro-metastatic phenotype through MET.
22624713 2012 Lunatic fringe deficiency cooperates with the Met/Caveolin gene amplicon to induce basal-like breast cancer.
22617325 2012 MET signaling regulates glioblastoma stem cells.
22606006 2012 Frequent gene amplification predicts poor prognosis in gastric cancer.
22590625 2012 Perifosine as a potential novel anti-cancer agent inhibits EGFR/MET-AKT axis in malignant pleural mesothelioma.
22580609 2013 The human Lgl polarity gene, Hugl-2, induces MET and suppresses Snail tumorigenesis.
22558359 2012 MET and AKT genetic influence on facial emotion perception.
22535954 2012 Fas ligand enhances malignant behavior of tumor cells through interaction with Met, hepatocyte growth factor receptor, in lipid rafts.
22526456 2012 Profiling immunohistochemical expression of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary.
22521434 2012 Hepatocyte growth factor (HGF) and 1,25-dihydroxyvitamin D together stimulate human bone marrow-derived stem cells toward the osteogenic phenotype by HGF-induced up-regulation of VDR.
22495710 Expression of the hepatocyte growth factor and c-Met in colon cancer: correlation with clinicopathological features and overall survival.
22493396 2012 Correlation of MACC1 and MET expression in rectal cancer after neoadjuvant chemoradiotherapy.
22447520 2012 Molecular genetic analysis of the hepatocyte growth factor/MET signaling pathway in pediatric medulloblastoma.
22418436 2012 Disturbance of Ca2+ homeostasis converts pro-Met into non-canonical tyrosine kinase p190MetNC in response to endoplasmic reticulum stress in MHCC97 cells.
22407230 2012 Lentivirus-mediated RNA silencing of c-Met markedly suppresses peritoneal dissemination of gastric cancer in vitro and in vivo.
22404908 2012 Effect of cancer-associated mutations in the PlexinB1 gene.
22395988 2012 Postoperative prognostic predictors of pancreatic ductal adenocarcinoma: clinical analysis and immunoprofile on tissue microarrays.
22389872 2011 Durable complete response of metastatic gastric cancer with anti-Met therapy followed by resistance at recurrence.
22383989 2012 Genetic susceptibility on CagA-interacting molecules and gene-environment interaction with phytoestrogens: a putative risk factor for gastric cancer.
22374333 2012 cMET and phospho-cMET protein levels in breast cancers and survival outcomes.
22367914 2012 The MET oncogene transforms human primary bone-derived cells into osteosarcomas by targeting committed osteo-progenitors.
22366451 2012 Met receptor tyrosine kinase signals through a cortactin-Gab1 scaffold complex, to mediate invadopodia.
22343615 2012 miRNA profiling in colorectal cancer highlights miR-1 involvement in MET-dependent proliferation.
22343486 2012 c-Met, epidermal growth factor receptor, and insulin-like growth factor-1 receptor are important for growth in uveal melanoma and independently contribute to migration and metastatic potential.
22301273 2012 The ganglioside G(D2) induces the constitutive activation of c-Met in MDA-MB-231 breast cancer cells expressing the G(D3) synthase.
22276607 2012 Immunohistochemical analysis of hepatocyte growth factor and c-Met in plasma cell disease.
22262855 2012 Met kinase-dependent loss of the E3 ligase Cbl in gastric cancer.
22246193 2012 Plasma cell membrane localization of c-MET predicts longer survival in patients with malignant mesothelioma: a series of 157 cases from the MESOPATH Group.
22238368 2012 MET activation mediates resistance to lapatinib inhibition of HER2-amplified gastric cancer cells.
22237262 2012 Correlation between MET gene copy number by silver in situ hybridization and protein expression by immunohistochemistry in non-small cell lung cancer.
22218908 2013 Clinical impact of c-Met expression and its gene amplification in hepatocellular carcinoma.
22207554 2012 High MET copy number and MET overexpression: poor outcome in non-small cell lung cancer patients.
22198430 2012 c-MET/phospho-MET protein expression and MET gene copy number in non-small cell lung carcinomas.
22194599 2012 Decorin antagonizes the angiogenic network: concurrent inhibition of Met, hypoxia inducible factor 1?, vascular endothelial growth factor A, and induction of thrombospondin-1 and TIMP3.
22188814 2012 Cooperation between c-Met and focal adhesion kinase family members in medulloblastoma and implications for therapy.
22180430 2012 Expression of the c-Met oncogene by tumor cells predicts a favorable outcome in classical Hodgkin's lymphoma.
22179665 2012 MiR-1 downregulation cooperates with MACC1 in promoting MET overexpression in human colon cancer.
22172411 2012 Expression of ezrin, HGF and c-met and its clinicopathological significance in the benign and malignant lesions of the gallbladder.
22157681 2011 EGFR and MET receptor tyrosine kinase-altered microRNA expression induces tumorigenesis and gefitinib resistance in lung cancers.
22152933 2011 [A simple view on lung cancer biology: the MET pathway].
22137795 2011 Mosaic amplification of multiple receptor tyrosine kinase genes in glioblastoma.
22135723 2011 Immunohistochemical expressions of fatty acid synthase and phosphorylated c-Met in thyroid carcinomas of follicular origin.
22127603 2012 HGF/C-MET system pathways in benign and malignant histotypes of thyroid nodules: an immunohistochemical characterization.
22110649 2011 Replication of the association of a MET variant with autism in a Chinese Han population.
22110593 2011 Activation of c-MET induces a stem-like phenotype in human prostate cancer.
22105362 2012 PAK1 is a breast cancer oncogene that coordinately activates MAPK and MET signaling.
22081023 2011 A hepatocyte growth factor receptor (Met)-insulin receptor hybrid governs hepatic glucose metabolism.
22052229 2011 Clinical implications of high MET gene dosage in non-small cell lung cancer patients without previous tyrosine kinase inhibitor treatment.
22047509 2011 Role of MetMAb (OA-5D5) in c-MET active lung malignancies.
22045810 2011 Protein-tyrosine phosphatase 1B modulates early endosome fusion and trafficking of Met and epidermal growth factor receptors.
22042954 2011 Genetic activation of the MET pathway and prognosis of patients with high-risk, radically resected gastric cancer.
22032640 2011 Involvement of lipid rafts in adhesion-induced activation of Met and EGFR.
22027690 2012 Breast cancer-derived bone metastasis can be effectively reduced through specific c-MET inhibitor tivantinib (ARQ 197) and shRNA c-MET knockdown.
22020736 2012 Association of activated c-Met with NRAS-mutated human melanomas.
21983935 2012 Accumulative copy number increase of MET drives tumor development and histological progression in a subset of ovarian clear-cell adenocarcinomas.
21982684 2012 EGFR and KRAS mutations and altered c-Met gene copy numbers in primary non-small cell lung cancer and associated stage N2 lymph node-metastasis.
21970370 2011 Activating mutation in MET oncogene in familial colorectal cancer.
21949730 2011 Gene signatures derived from a c-MET-driven liver cancer mouse model predict survival of patients with hepatocellular carcinoma.
21922276 2011 Silencing of c-Met by RNA interference inhibits the survival, proliferation, and invasion of nasopharyngeal carcinoma cells.
21922134 2012 Inhibition of HGF/cMET expression prevents distant recurrence of rectal cancer after preoperative chemoradiotherapy.
21920521 2011 HGF/c-Met signalling promotes Notch3 activation and human vascular smooth muscle cell osteogenic differentiation in vitro.
21917713 2011 Met receptor: a moving target.
21872356 2012 Abnormality of the hepatocyte growth factor/MET pathway in pulmonary adenocarcinogenesis.
21832174 2011 Regulation of MET by FOXP2, genes implicated in higher cognitive dysfunction and autism risk.
21831840 2011 Wild-type p53 controls cell motility and invasion by dual regulation of MET expression.
21796631 2012 Co-expression of hepatocyte growth factor and c-Met predicts peritoneal dissemination established by autocrine hepatocyte growth factor/c-Met signaling in gastric cancer.
21784853 2011 Distinct involvement of the Gab1 and Grb2 adaptor proteins in signal transduction by the related receptor tyrosine kinases RON and MET.
21782801 2011 Degradation of the GAB1 adaptor by the ubiquitin-proteasome pathway hampers HGF/SF-MET signaling.
21779788 2012 HGF/c-Met overexpressions, but not met mutation, correlates with progression of non-small cell lung cancer.
21751142 2011 Up-regulated expression of Ezrin and c-Met proteins are related to the metastasis and prognosis of gastric carcinomas.
21733594 2012 Co-existence of positive MET FISH status with EGFR mutations signifies poor prognosis in lung adenocarcinoma patients.
21729677 2011 Is there a role for IGF1R and c-MET pathways in resistance to cetuximab in metastatic colorectal cancer?
21716144 2011 MET tyrosine kinase inhibitor crizotinib (PF-02341066) shows differential antitumor effects in non-small cell lung cancer according to MET alterations.
21706050 2012 miR-130a targets MET and induces TRAIL-sensitivity in NSCLC by downregulating miR-221 and 222.
21703197 2011 c-Met activation through a novel pathway involving osteopontin mediates oncogenesis by the transcription factor LSF.
21697284 2011 A drug resistance screen using a selective MET inhibitor reveals a spectrum of mutations that partially overlap with activating mutations found in cancer patients.
21687954 2011 Expression of MET and SOX2 genes in non-small cell lung carcinoma with EGFR mutation.
21680714 2011 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21673683 2011 Prognostic significance of overexpression of c-Met oncoprotein in cholangiocarcinoma.
21658389 2011 miR-198 inhibits migration and invasion of hepatocellular carcinoma cells by targeting the HGF/c-MET pathway.
21642981 2011 A direct role for Met endocytosis in tumorigenesis.
21628563 2011 c-Met signaling induces a reprogramming network and supports the glioblastoma stem-like phenotype.
21623265 2011 Activity of crizotinib (PF02341066), a dual mesenchymal-epithelial transition (MET) and anaplastic lymphoma kinase (ALK) inhibitor, in a non-small cell lung cancer patient with de novo MET amplification.
21622718 2011 Dual blockade of EGFR and c-Met abrogates redundant signaling and proliferation in head and neck carcinoma cells.
21595927 2011 HGF/c-met/Stat3 signaling during skin tumor cell invasion: indications for a positive feedback loop.
21540237 2011 Activated MET is a molecular prognosticator and potential therapeutic target for malignant peripheral nerve sheath tumors.
21531000 2011 Intratumoral c-Met expression is associated with vascular endothelial growth factor C expression, lymphangiogenesis, and lymph node metastasis in oral squamous cell carcinoma: implications for use as a prognostic marker.
21514418 2011 Diminished met signaling in podocytes contributes to the development of podocytopenia in transplant glomerulopathy.
21504731 2011 A role for septins in the interaction between the Listeria monocytogenes INVASION PROTEIN InlB and the Met receptor.
21500189 2012 A preclinical algorithm of soluble surrogate biomarkers that correlate with therapeutic inhibition of the MET oncogene in gastric tumors.
21496277 2011 Transcriptional activation of the Axl and PDGFR-? by c-Met through a ras- and Src-independent mechanism in human bladder cancer.
21486864 2011 An interaction between hepatocyte growth factor and its receptor (c-MET) prolongs the survival of chronic lymphocytic leukemic cells through STAT3 phosphorylation: a potential role of mesenchymal cells in the disease.
21478826 2011 Gene amplification and protein overexpression of MET are common events in ovarian clear-cell adenocarcinoma: their roles in tumor progression and prognostication of the patient.
21468575 Knockdown of c-Met inhibits cell proliferation and invasion and increases chemosensitivity to doxorubicin in human multiple myeloma U266 cells in vitro.
21455220 2011 Abl interconnects oncogenic Met and p53 core pathways in cancer cells.
21454675 2011 Receptor-type protein tyrosine phosphatase beta (RPTP-beta) directly dephosphorylates and regulates hepatocyte growth factor receptor (HGFR/Met) function.
21454604 2011 Discovery of a novel mode of protein kinase inhibition characterized by the mechanism of inhibition of human mesenchymal-epithelial transition factor (c-Met) protein autophosphorylation by ARQ 197.
21447729 2011 Genetic and expression analysis of MET, MACC1, and HGF in metastatic colorectal cancer: response to met inhibition in patient xenografts and pathologic correlations.
21445634 2011 Involvement of HER-2/neu and metastasis-related proteins in the development of ileal neuroendocrine tumors.
21424128 2011 Impact of MET amplification on gastric cancer: possible roles as a novel prognostic marker and a potential therapeutic target.
21423210 2011 HGF-independent potentiation of EGFR action by c-Met.
21412276 2011 Enhanced neuronal Met signalling levels in ALS mice delay disease onset.
21393565 2011 MET expression and amplification in patients with localized gastric cancer.
21383285 2011 Phase I trial of a selective c-MET inhibitor ARQ 197 incorporating proof of mechanism pharmacodynamic studies.
21354913 2011 [Detection of epidermal growth factor receptor and c-Met gene copies for prognostic evaluation of non-small cell lung cancer].
21302810 2010 Tumor MET expression may not predict the risk of venous thromboembolism in cancer patients.
21299348 2011 The expression pattern of Von Hippel-Lindau tumor suppressor protein, MET proto-oncogene, and TFE3 transcription factor oncoprotein in renal cell carcinoma in Upper Egypt.
21269460 2011 Initial characterization of the human central proteome.
21247903 2011 Structural basis for selective small molecule kinase inhibition of activated c-Met.
21242965 2011 hTID-1 defines a novel regulator of c-Met Receptor signaling in renal cell carcinomas.
21223687 2010 [Clinicopathological features and prognostic implications of EGFR/c-Met gene copy number and protein expression in non-small cell lung cancer].
21222362 2010 Altered down regulation of the receptor tyrosine kinase met in pancreatic adenocarcinoma cells.
21220347 2011 Chromosomal amplification of leucine-rich repeat kinase-2 (LRRK2) is required for oncogenic MET signaling in papillary renal and thyroid carcinomas.
21217780 2011 c-Met-induced epithelial carcinogenesis is initiated by the serine protease matriptase.
21212418 2011 Ron kinase transphosphorylation sustains MET oncogene addiction.
21168200 2011 The expression of hepatocyte growth factor (HGF) and c-Met in uterine serous carcinoma.
21163258 2011 An adjacent arginine, and the phosphorylated tyrosine in the c-Met receptor target sequence, dictates the orientation of c-Cbl binding.
21119598 2011 Ligand-independent activation of c-Met by fibronectin and ?(5)?(1)-integrin regulates ovarian cancer invasion and metastasis.
21098327 2011 CCND1 and MET genomic amplification during malignant transformation of a giant cell tumor of bone.
21057531 2011 Inhibition of c-Met downregulates TIGAR expression and reduces NADPH production leading to cell death.
21043826 2010 Expression patterns of PAX5, c-Met, and paxillin in neuroendocrine tumors of the lung.
20974860 2010 Decorin antagonizes Met receptor activity and down-regulates {beta}-catenin and Myc levels.
20949619 2011 MET mutations in cancers of unknown primary origin (CUPs).
20946682 2010 Efficacy of c-Met inhibitor for advanced prostate cancer.
20937841 2010 Allosteric peptide activators of pro-hepatocyte growth factor stimulate Met signaling.
20927591 2011 Expression and prognostic significance of CD151, c-Met, and integrin alpha3/alpha6 in pancreatic ductal adenocarcinoma.
20832323 2011 c-Met expression is associated with time to recurrence in patients with glioblastoma multiforme.
20802513 2011 Phosphorylation of focal adhesion kinase on tyrosine 194 by Met leads to its activation through relief of autoinhibition.
20687930 2010 Breast tumor kinase and extracellular signal-regulated kinase 5 mediate Met receptor signaling to cell migration in breast cancer cells.
20670955 2010 MET receptor sequence variants R970C and T992I lack transforming capacity.
20661229 2011 HGF/c-Met pathway has a prominent role in mediating antiapoptotic signals through AKT in epithelial ovarian carcinoma.
20661223 2010 Sprouty-2 controls c-Met expression and metastatic potential of colon cancer cells: sprouty/c-Met upregulation in human colonic adenocarcinomas.
20655987 2010 The HGF/MET pathway as target for the treatment of multiple myeloma and B-cell lymphomas.
20655899 2010 Hepatocyte growth factor protects human embryonic stem cell derived-neural progenitors from hydrogen peroxide-induced apoptosis.
20639860 2010 Prognostic implication of MET overexpression in myxofibrosarcomas: an integrative array comparative genomic hybridization, real-time quantitative PCR, immunoblotting, and immunohistochemical analysis.
20624308 2010 EGFR/Met association regulates EGFR TKI resistance in breast cancer.
20617367 2011 Gain of chromosome 7 by chromogenic in situ hybridization (CISH) in chordomas is correlated to c-MET expression.
20615438 2010 Further evidence for the role of MET in autism susceptibility.
20580899 2010 Increased HGF and c-Met in muscle tissues of polymyositis and dermatomyositis patients: beneficial roles of HGF in muscle regeneration.
20562909 2010 Demethylation of a LINE-1 antisense promoter in the cMet locus impairs Met signalling through induction of illegitimate transcription.
20558345 2010 The tyrosine kinase receptor c-met, its cognate ligand HGF and the tyrosine kinase receptor trasducers STAT3, PI3K and RHO in thyroid nodules associated with Hashimoto's thyroiditis: an immunohistochemical characterization.
20545554 2010 Human hepatocyte growth factor receptor is a cellular coreceptor for adeno-associated virus serotype 3.
20529867 2010 Dorsal ruffle microdomains potentiate Met receptor tyrosine kinase signaling and down-regulation.
20529820 2010 Correlation between hepatocyte growth factor receptor and vascular endothelial growth factor-A in breast carcinoma.
20514461 2010 c-Met antisense oligodeoxynucleotides increase sensitivity of human glioma cells to paclitaxel.
20512480 2010 MET overexpressing chordomas frequently exhibit polysomy of chromosome 7 but no MET activation through sarcoma-specific gene fusions.
20489150 2010 Met activation in non-small cell lung cancer is associated with de novo resistance to EGFR inhibitors and the development of brain metastasis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20421991 2010 Hypomethylation of a LINE-1 promoter activates an alternate transcript of the MET oncogene in bladders with cancer.