Property Summary

Ligand Count 1,274
NCBI Gene PubMed Count 989
PubMed Score 2013.66
PubTator Score 1522.99

Knowledge Summary

Patent (373,429)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.9
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 0.00586379277442461
Disease Target Count Z-score Confidence
Cancer 2499 6.409 3.2
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -1.200 5.9e-03
Breast cancer -2.300 2.6e-02
glioblastoma -2.700 1.9e-02
osteosarcoma 3.177 3.1e-07
ovarian cancer -3.300 5.7e-06
astrocytic glioma -2.600 5.3e-03
atypical teratoid / rhabdoid tumor -3.700 2.0e-05
Barrett's esophagus 1.500 1.9e-02
breast carcinoma -1.500 1.4e-05
colon cancer 1.200 3.5e-02
esophageal adenocarcinoma 2.200 2.0e-02
group 3 medulloblastoma -1.100 4.0e-03
interstitial lung disease 1.200 3.5e-02
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
invasive ductal carcinoma -2.100 1.1e-04
lung carcinoma -3.200 2.0e-27
medulloblastoma, large-cell -4.200 1.7e-03
oligodendroglioma -2.600 7.0e-03
pancreatic cancer 2.300 9.7e-09
pituitary cancer -2.500 2.0e-05
primitive neuroectodermal tumor -3.500 1.6e-03
psoriasis -1.100 3.3e-03
tuberculosis -6.000 4.8e-11
ulcerative colitis 1.200 1.8e-04

PDB (78)

Gene RIF (918)

AA Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI      1 - 70
YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT     71 - 140
CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP    141 - 210
LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR    211 - 280
FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK    281 - 350
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF    351 - 420
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV    421 - 490
IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI    491 - 560
CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM    561 - 630
NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK    631 - 700
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV    701 - 770
SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV    771 - 840
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE    841 - 910
WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL    911 - 980
DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT    981 - 1050
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE   1051 - 1120
VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK   1121 - 1190
GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF   1191 - 1260
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF   1261 - 1330
SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS             1331 - 1390
//

Text Mined References (1016)

PMID Year Title