Property Summary

Ligand Count 1,248
NCBI Gene PubMed Count 989
PubMed Score 2013.66
PubTator Score 1522.99

Knowledge Summary

Patent (373,429)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.9
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 0.00586379277442461
Disease Target Count Z-score Confidence
Cancer 2499 6.409 3.2
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -1.200 5.9e-03
Breast cancer -2.300 2.6e-02
glioblastoma -2.700 1.9e-02
osteosarcoma 3.177 3.1e-07
ovarian cancer -3.300 5.7e-06
astrocytic glioma -2.600 5.3e-03
atypical teratoid / rhabdoid tumor -3.700 2.0e-05
Barrett's esophagus 1.500 1.9e-02
breast carcinoma -1.500 1.4e-05
colon cancer 1.200 3.5e-02
esophageal adenocarcinoma 2.200 2.0e-02
group 3 medulloblastoma -1.100 4.0e-03
interstitial lung disease 1.200 3.5e-02
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
invasive ductal carcinoma -2.100 1.1e-04
lung carcinoma -3.200 2.0e-27
medulloblastoma, large-cell -4.200 1.7e-03
oligodendroglioma -2.600 7.0e-03
pancreatic cancer 2.300 9.7e-09
pituitary cancer -2.500 2.0e-05
primitive neuroectodermal tumor -3.500 1.6e-03
psoriasis -1.100 3.3e-03
tuberculosis -6.000 4.8e-11
ulcerative colitis 1.200 1.8e-04

Synonym

Accession P08581 A1L467 B5A932 E7EQ94 O60366 Q12875 Q9UDX7 Q9UPL8 HGF receptor
Symbols HGFR
AUTS9
RCCP2
c-Met
DFNB97

Gene

MET

PDB

1SHY   4K3J   4O3T   4O3U   1FYR   1R0P   1R1W   1SSL   1UX3   2G15   2RFN   2RFS   2UZX   2UZY   2WD1   2WGJ   2WKM   3A4P   3BUX   3C1X   3CCN   3CD8   3CE3   3CTH   3CTJ   3DKC   3DKF   3DKG   3EFJ   3EFK   3F66   3F82   3I5N   3L8V   3LQ8   3Q6U   3Q6W   3QTI   3R7O   3RHK   3U6H   3U6I   3VW8   3ZBX   3ZC5   3ZCL   3ZXZ   3ZZE   4AOI   4AP7   4DEG   4DEH   4DEI   4EEV   4GG5   4GG7   4IWD   4KNB   4MXC   4R1V   4R1Y   4XMO   4XYF   5DG5   5EOB   5EYC   5EYD   5HLW   5HNI   5HO6   5HOA   5HOR   5HTI   5LSP   5T3Q   5UAB   5UAD   5UAF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (918)

AA Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI      1 - 70
YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT     71 - 140
CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP    141 - 210
LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR    211 - 280
FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK    281 - 350
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF    351 - 420
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV    421 - 490
IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI    491 - 560
CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM    561 - 630
NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK    631 - 700
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV    701 - 770
SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV    771 - 840
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE    841 - 910
WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL    911 - 980
DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT    981 - 1050
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE   1051 - 1120
VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK   1121 - 1190
GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF   1191 - 1260
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF   1261 - 1330
SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS             1331 - 1390
//

Text Mined References (1016)

PMID Year Title