Property Summary

NCBI Gene PubMed Count 9
PubMed Score 26.77
PubTator Score 25.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis -1.095 7.4e-03
adult high grade glioma -1.200 1.3e-02
astrocytic glioma -1.300 1.3e-02
atypical teratoid / rhabdoid tumor -1.300 1.4e-06
breast carcinoma -1.200 7.1e-03
ductal carcinoma in situ -2.300 5.8e-04
ependymoma -1.500 3.5e-02
facioscapulohumeral dystrophy 1.300 1.6e-02
fibroadenoma -1.200 3.9e-02
glioblastoma -1.500 3.6e-04
lung adenocarcinoma 2.000 1.1e-07
medulloblastoma -1.300 2.2e-03
medulloblastoma, large-cell -1.800 1.5e-04
osteosarcoma 1.959 2.0e-09
ovarian cancer 1.600 2.2e-12
pituitary cancer 1.100 1.9e-04
primitive neuroectodermal tumor -1.300 6.0e-03
subependymal giant cell astrocytoma -1.335 1.3e-02

 GO Component (1)

Gene RIF (5)

AA Sequence

MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVG      1 - 70
RRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVL     71 - 140
GLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGA    141 - 210
RAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK                211 - 268
//

Text Mined References (11)

PMID Year Title