Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.26
PubTator Score 26.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (8)

PMID Text
23469146 Mesd C-terminal region constitutes the major LRP5/6-binding domain, and that Mesd protein and its C-terminal region peptide have a potential therapeutic value in cancer
22190034 HIV-1 gp160 is identified to have a physical interaction with mesoderm development candidate 2 (MESDC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21907199 Results indicate that Mesd is a universal inhibitor of Wnt/LRP signaling on the cell surface.
21397183 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/LRP6.
21337463 Results provide evidence that MESD functions as a general LRP chaperone and suggest that the Mesd phenotype results from both signaling and endocytic defects resulting from misfolding of multiple LRP receptors.
19746449 a high bone mass mutant LRP5(G171V), has subtly reduced Dkk1 binding, and, in contrast to LRP5, no enhancement of binding with MesD
16989816 Mesd and LRP6 modulate Wnt signaling.
15917269 as a result of (12;15)(q13;q25)translocation, the SUMO/Sentrin-specific protease 1 gene (SENP1) on chromosome 12 and the embryonic polarity-related mesoderm development gene (MESDC2) on chromosome 15 are disrupted and fused

AA Sequence

MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQW      1 - 70
EKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSL     71 - 140
FNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKK    141 - 210
KKEGDLKSRSSKEENRAGNKREDL                                                  211 - 234
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23469146 2013 The C-terminal region Mesd peptide mimics full-length Mesd and acts as an inhibitor of Wnt/?-catenin signaling in cancer cells.
21907199 2011 Mesd is a general inhibitor of different Wnt ligands in Wnt/LRP signaling and inhibits PC-3 tumor growth in vivo.
21397183 2011 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/6.
21337463 2011 MESD is essential for apical localization of megalin/LRP2 in the visceral endoderm.
21269460 2011 Initial characterization of the human central proteome.
19746449 2009 A cell-based Dkk1 binding assay reveals roles for extracellular domains of LRP5 in Dkk1 interaction and highlights differences between wild-type and the high bone mass mutant LRP5(G171V).
17488095 2007 Requirement for natively unstructured regions of mesoderm development candidate 2 in promoting low-density lipoprotein receptor-related protein 6 maturation.
16989816 2006 Modulation of LRP6-mediated Wnt signaling by molecular chaperone Mesd.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15917269 2005 Fusion of the SUMO/Sentrin-specific protease 1 gene SENP1 and the embryonic polarity-related mesoderm development gene MESDC2 in a patient with an infantile teratoma and a constitutional t(12;15)(q13;q25).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014448 2004 Boca-dependent maturation of beta-propeller/EGF modules in low-density lipoprotein receptor proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12581525 2003 Mesd encodes an LRP5/6 chaperone essential for specification of mouse embryonic polarity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11247670 2001 Identification of mesoderm development (mesd) candidate genes by comparative mapping and genome sequence analysis.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.