Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.48
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.002 9.4e-07
astrocytic glioma -1.300 5.7e-03
Astrocytoma, Pilocytic -1.100 2.5e-06
ependymoma -1.400 6.2e-03
juvenile dermatomyositis 1.313 4.0e-12
non-small cell lung cancer -1.209 3.1e-18
oligodendroglioma -1.200 4.7e-03
osteosarcoma 1.792 6.6e-07
tuberculosis and treatment for 6 months 1.100 1.4e-02

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MASGSAGKPTGEAASPAPASAIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA      1 - 70
GAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGDSLVELGDLVVSLTECSAHAAYLAAVATPGA     71 - 140
QPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFS    141 - 210
REQFKLGVKCMSTSASALLACVREVKVAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSAE    211 - 280
GKAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSP    281 - 350
RTLPPVNSNSVN                                                              351 - 362
//

Text Mined References (7)

PMID Year Title