Property Summary

NCBI Gene PubMed Count 30
PubMed Score 141.14
PubTator Score 73.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
primitive neuroectodermal tumor -1.100 5.3e-03

Gene RIF (19)

PMID Text
23570370 Results indicate an association of MEPE gene inactivation with decreased survival after DNA damage.
22341070 results indicated that MEPE appeared to play an important positive role in proliferation and osteogenesis differentiation of DPCs through interaction with downstream signals.
21779381 Among migraineurs with aura rs7698623 in MEPE (OR = 6.37; 95% CI 3.15-12.90; p = 2.7x10(-7)) and rs4975709 in IRX4 (OR = 5.06; 95% CI 2.66-9.62; p = 7.7x10(-7)) appeared to be associated with ischemic stroke.
21739089 MEPE or the MEPE-derived acidic serine aspartate-rich MEPE-associated motif peptide may contribute to decreased bone mineralization in Oncogenic osteomalacia patients.
21312267 Sclerostin acts through regulation of the PHEX/MEPE axis at the preosteocyte stage and serves as a master regulator of physiologic bone mineralization.
20581062 These results suggest that abnormal MEPE cleavage occurs when PHEX activity is deficient in humans.
19998030 This study demonstrates the importance of posttranslational modification for the site-specific activity of MEPE and its ASARM peptide.
19679205 The patterns of expression of FGF-23, MEPE, and DMP1 differ markedly in trabecular bone, suggesting that individual osteocytes may have specialized functions.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19031789 MEPE may play a regulatory role in periodontal ligament cell osteogenic differentiation.
19005008 MEPE is a candidate phosphatonin involved in phosphate homeostasis, acting in both the kidney and the gastrointestinal tract
18547474 MEPE expression is higher when cells proliferate, whereas it is downregulated as cells differentiated
15954904 MEPE is expressed on the luminal surface of kidney proximal tubules.
15329369 MEPE is expressed in salivary gland ducts.
15292364 The results are consistent with MEPE being involved in phosphate and bone metabolism in a normal population.
15108058 MEPE is predominantly expressed by osteocytes in human bone, with significant expression by osteocytes within mineralized bone
12791601 There is evidence for a hormone/enzyme/extracellular matrix protein cascade involving fibroblastic growth factor 23 (FGF23), a phosphate-regulating gene with homologies to (PHEX) and (MEPE)--REVIEW
12489176 MEPE/OF45, a new dentin/bone matrix protein and candidate gene for dentin diseases mapping to chromosome 4q21. Expressed during odontogenesis.
12421822 Mice deficient in an ortholog of MEPE show increased bone mass and are resistant to aging-related bone loss.

AA Sequence

MRVFCVGLLLFSVTWAAPTFQPQTEKTKQSCVEEQRQEEKNKDNIGFHHLGKRINQELSSKENIVQERKK      1 - 70
DLSLSEASENKGSSKSQNYFTNRQRLNKEYSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQE     71 - 140
EYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKS    141 - 210
KSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPDLEGKD    211 - 280
IQTGFAGPSEAESTHLDTKKPGYNEIPEREENGGNTIGTRDETAKEADAVDVSLVEGSNDIMGSTNFKEL    281 - 350
PGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEIPKNGKGSTRKGVDHSNRNQAT    351 - 420
LNEKQRFPSKGKSQGLPIPSRGLDNEIKNEMDSFNGPSHENIITHGRKYHYVPHRQNNSTRNKGMPQGKG    421 - 490
SWGRQPHSNRRFSSRRRDDSSESSDSGSSSESDGD                                       491 - 525
//

Text Mined References (33)

PMID Year Title
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24255709 2013 Increased expression of matrix extracellular phosphoglycoprotein (MEPE) in cortical bone of the rat tibia after mechanical loading: identification by oligonucleotide microarray.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23570370 2013 MicroRNA-376a sensitizes cells following DNA damage by downregulating MEPE expression.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22582013 2012 Secreted kinase phosphorylates extracellular proteins that regulate biomineralization.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22341070 2012 The effect of matrix extracellular phosphoglycoprotein and its downstream osteogenesis-related gene expression on the proliferation and differentiation of human dental pulp cells.
21779381 2011 Genetic determinants of cardiovascular events among women with migraine: a genome-wide association study.
21739089 2012 Matrix extracellular phosphoglycoprotein is expressed in causative tumors of oncogenic osteomalacia.
21312267 2011 Sclerostin is a locally acting regulator of late-osteoblast/preosteocyte differentiation and regulates mineralization through a MEPE-ASARM-dependent mechanism.
20581062 2010 Abnormal presence of the matrix extracellular phosphoglycoprotein-derived acidic serine- and aspartate-rich motif peptide in human hypophosphatemic dentin.
19998030 2010 MEPE's diverse effects on mineralization.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19679205 2009 Patterns of FGF-23, DMP1, and MEPE expression in patients with chronic kidney disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19031789 2008 [Expression of matrix extracellular phosphoglycoprotein mRNA in human periodontal ligament cell osteogenic differentiation].
19005008 2008 Matrix extracellular phosphoglycoprotein inhibits phosphate transport.
18547474 Changes in matrix extracellular phosphoglycoprotein expression before and during in vitro osteogenic differentiation of human dental papilla mesenchymal cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15954904 2005 Renal expression of SIBLING proteins and their partner matrix metalloproteinases (MMPs).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329369 2004 Expression of SIBLINGs and their partner MMPs in salivary glands.
15292364 2004 Serum levels of matrix extracellular phosphoglycoprotein (MEPE) in normal humans correlate with serum phosphorus, parathyroid hormone and bone mineral density.
15108058 2004 Matrix extracellular phosphoglycoprotein (MEPE) is highly expressed in osteocytes in human bone.
14962809 2004 MEPE has the properties of an osteoblastic phosphatonin and minhibin.
12791601 2003 FGF23, PHEX, and MEPE regulation of phosphate homeostasis and skeletal mineralization.
12489176 2002 MEPE/OF45, a new dentin/bone matrix protein and candidate gene for dentin diseases mapping to chromosome 4q21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421822 2003 Targeted disruption of the osteoblast/osteocyte factor 45 gene (OF45) results in increased bone formation and bone mass.
11414762 2001 Mepe, the gene encoding a tumor-secreted protein in oncogenic hypophosphatemic osteomalacia, is expressed in bone.
10945470 2000 MEPE, a new gene expressed in bone marrow and tumors causing osteomalacia.