Property Summary

NCBI Gene PubMed Count 34
PubMed Score 33.36
PubTator Score 37.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
colon cancer 1475 1.3e-07
lung carcinoma 2844 1.4e-06
ulcerative colitis 2087 1.0e-03
lung cancer 4473 1.3e-03
active Crohn's disease 918 2.3e-02
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.78 1.9
Dentinogenesis imperfecta 24 3.316 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -2.500 1.3e-07
lung cancer 1.900 1.3e-03
active Crohn's disease -2.964 2.3e-02
lung carcinoma 1.600 1.4e-06
ulcerative colitis -3.400 1.0e-03

Gene RIF (17)

PMID Text
26251449 Meprin Beta was found to be activated at the cell surface by matriptase-2.
25855967 n conclusion, we show that the concept of cleavable linkers specific for meprin beta is feasible, as the peptides are rapidly cleaved by the enzyme while retaining their biological properties
24474695 Meprin metalloproteases A and B inactivate interleukin 6
24258247 Suggest role for in meprin-beta-Fra2 axis in mediating vascular remodelling in pulmonary hypertension.
24239627 promotes inflammation in macrophages via ADAM-10 dependent pathway
24114056 Overexpression of MEP1B is associated with pancreatic neuroendocrine tumors.
22940918 of the 151 new extracellular substrates identified, it was notable that ADAM10 the constitutive alpha-secretase-is activated by meprin beta through cleavage of the propeptide
22879596 metalloprotease meprin beta generates amino terminal-truncated amyloid beta peptide species
21646356 Processing of APP by meprin beta was subsequently validated using in vitro and in vivo approaches. N-terminal APP fragments of about 11 and 20 kDa were found in human and mouse brain lysates but not in meprin beta(-/-) mouse brain lysates
20953144 Demonstrate that the metalloprotease meprin beta and gamma-ENaC associate directly through cytoplasmic domains.
20806899 Cystatin C was an inhibitor for human meprin alpha(K(i) = 8.5 x 10(-6) M) but, interestingly, not for meprin beta.
20631730 meprins could be important players in several remodeling processes involving collagen fiber deposition
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19748582 data indicate that, at least under pathological conditions, meprinbeta might attack specific functional sites in tenascin-C that are important for its oligomerization and anti-adhesive activity
17195012 Mephrin beta induced a dramatic change in cell morphology and reduced the cell number, indicating a function in terminal differentiation, whereas meprin alpha did not affect cell viability, and may play a role in basal keratinocyte proliferation.
12941954 two different metalloprotease activities are responsible for the constitutive and the PMA-stimulated hmeprinbeta shedding
12387727 results show that the O-linked carbohydrate side chains in hmeprinbeta are clustered around a 13 amino acid sequence that contains the main cleavage site for proteolytic processing of the subunit

AA Sequence

MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR      1 - 70
WPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGSGCWSSVGNRRVGKQELSI     71 - 140
GANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMH    141 - 210
YSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSG    211 - 280
DNADWQRVSQVPRGPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGS    281 - 350
ESDQLNIYIREYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI    351 - 420
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQW    421 - 490
PCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSNGTQFRRGGGYGTS    491 - 560
AFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTVRDGKAECRC    561 - 630
QSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHA    631 - 700
F//

Text Mined References (42)

PMID Year Title
26251449 2015 Metalloprotease meprin ? is activated by transmembrane serine protease matriptase-2 at the cell surface thereby enhancing APP shedding.
25855967 2015 Evaluation of ¹¹¹in-labelled exendin-4 derivatives containing different meprin ?-specific cleavable linkers.
24474695 2014 Meprin metalloproteases inactivate interleukin 6.
24258247 2014 Meprin ?, a novel mediator of vascular remodelling underlying pulmonary hypertension.
24239627 2014 Meprin-? regulates production of pro-inflammatory factors via a disintegrin and metalloproteinase-10 (ADAM-10) dependent pathway in macrophages.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
23123160 2012 Meprins process matrix metalloproteinase-9 (MMP-9)/gelatinase B and enhance the activation kinetics by MMP-3.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22988105 2012 Structural basis for the sheddase function of human meprin ? metalloproteinase at the plasma membrane.
22940918 2013 The substrate degradome of meprin metalloproteases reveals an unexpected proteolytic link between meprin ? and ADAM10.
22879596 2012 The metalloprotease meprin ? generates amino terminal-truncated amyloid ? peptide species.
21693781 2011 Proteomic analyses reveal an acidic prime side specificity for the astacin metalloprotease family reflected by physiological substrates.
21646356 2011 Metalloprotease meprin beta generates nontoxic N-terminal amyloid precursor protein fragments in vivo.
20953144 Activation of the epithelial sodium channel by the metalloprotease meprin ? subunit.
20806899 2010 Fetuin-A and cystatin C are endogenous inhibitors of human meprin metalloproteases.
20631730 2010 Processing of procollagen III by meprins: new players in extracellular matrix assembly?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19748582 2010 Specific processing of tenascin-C by the metalloprotease meprinbeta neutralizes its inhibition of cell spreading.
18786924 2008 Prointerleukin-18 is activated by meprin beta in vitro and in vivo in intestinal inflammation.
18478055 2008 The metalloprotease meprinbeta processes E-cadherin and weakens intercellular adhesion.
17195012 2007 The alpha and beta subunits of the metalloprotease meprin are expressed in separate layers of human epidermis, revealing different functions in keratinocyte proliferation and differentiation.
16095909 2005 Generation of biologically active interleukin-1beta by meprin B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12941954 2003 Phorbol 12-myristate 13-acetate-induced ectodomain shedding and phosphorylation of the human meprinbeta metalloprotease.
12888571 2003 Critical amino acids in the active site of meprin metalloproteinases for substrate and peptide bond specificity.
12556482 2003 Targeted disruption of the meprin beta gene in mice leads to underrepresentation of knockout mice and changes in renal gene expression profiles.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399461 2003 Structure of homo- and hetero-oligomeric meprin metalloproteases. Dimers, tetramers, and high molecular mass multimers.
12387727 2003 Human meprin beta: O-linked glycans in the intervening region of the type I membrane protein protect the C-terminal region from proteolytic cleavage and diminish its secretion.
12093806 2002 A selective interaction between OS-9 and the carboxyl-terminal tail of meprin beta.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
11267665 2001 Developmental expression of meprin metalloprotease subunits in ICR and C3H/He mouse kidney and intestine in the embryo, postnatally and after weaning.
10215852 1999 N-Benzoyl-L-tyrosyl-p-aminobenzoic acid hydrolase beta (human meprinbeta). A 13-amino-acid sequence is required for proteolyticprocessing and subsequent secretion.
9914532 1999 Secretion of human meprin from intestinal epithelial cells depends on differential expression of the alpha and beta subunits.
9288916 1997 Polarised expression of human intestinal N-benzoyl-L-tyrosyl-p-aminobenzoic acid hydrolase (human meprin) alpha and beta subunits in Madin-Darby canine kidney cells.
8939981 1996 The cleavage of protein kinase A by the kinase-splitting membranal proteinase is reproduced by meprin beta.
8760356 1996 Identification of the cysteine residues implicated in the formation of alpha 2 and alpha/beta dimers of rat meprin.
8660687 1996 Expression and distribution of meprin protease subunits in mouse intestine.
8262185 1993 Cloning of the PABA peptide hydrolase alpha subunit (PPH alpha) from human small intestine and its expression in COS-1 cells.
8063866 1994 An old enzyme with a new function: purification and characterization of a distinct matrix-degrading metalloproteinase in rat kidney cortex and its identification as meprin.
7774936 1995 The structural genes, MEP1A and MEP1B, for the alpha and beta subunits of the metalloendopeptidase meprin map to human chromosomes 6p and 18q, respectively.
7710697 1994 Purification of meprin from human kidney and its role in parathyroid hormone degradation.