Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.00
PubTator Score 29.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Colonic Neoplasms 126
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.37 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 2.900 2.6e-02
colon cancer -2.400 2.1e-04
active Crohn's disease -1.441 1.0e-02
ulcerative colitis -2.200 4.2e-06

Gene RIF (13)

PMID Text
24474695 Meprin metalloproteases A and B inactivate interleukin 6
24388959 Variants rs17468190 (G/T) in the MEP1A gene are associated with glucose and insulin metabolism in overweight/obese central European women with polycystic ovary syndrome.
22923609 Proteolytically active meprinalpha leads to an increase in EGFR and ERK1/2 phosphorylation and subsequently enhances cell proliferation and migration
22326557 The present results indicate that a TNF-alpha-mediated down-regulation of CDX2 can be related to suppressed expression of MEP1A during intestinal inflammation.
22096485 Meprin-alpha activity is regulated differently in primary tumors and metastases of colorectal cancer. By virtue of its pro-migratory and pro-angiogenic activity, meprin-alpha may promote tumor progression in colorectal cancer.
20806899 Cystatin C was an inhibitor for human meprin alpha(K(i) = 8.5 x 10(-6) M) but, interestingly, not for meprin beta.
20631730 meprins could be important players in several remodeling processes involving collagen fiber deposition
19262505 MEP1A is a UC susceptibility gene and indicate that decreased meprin-alpha expression is associated with intestinal inflammation in IBD patients and in a mouse experimental model of IBD.
19262505 Observational study of gene-disease association. (HuGE Navigator)
17195012 Mephrin beta induced a dramatic change in cell morphology and reduced the cell number, indicating a function in terminal differentiation, whereas meprin alpha did not affect cell viability, and may play a role in basal keratinocyte proliferation.
16378686 Observational study of gene-disease association. (HuGE Navigator)
16378686 The combination of these polymorphisms could not be found in any control individuals, suggesting that they might be involved in genetic predisposition to migraine in this family.
12189145 activation in colorectal cancer triggered by the plasminogen-activating system

AA Sequence

MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILLQKSRNGLRD      1 - 70
PNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFDGCWSEVGDQHVGQN     71 - 140
ISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYES    141 - 210
LMHYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMI    211 - 280
QGTRDDTDWAHQDSAQAGEVDHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKM    281 - 350
TGSPSDRLVVWVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY    351 - 420
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSGYLRLAFHVCS    421 - 490
GENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCF    491 - 560
RSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGS    561 - 630
GKAMLEEALPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGH    631 - 700
AFFYTGERCQAVQVHGSVLGMVIGGTAGVIFLTFSIIAILSQRPRK                            701 - 746
//

Text Mined References (36)

PMID Year Title
24474695 2014 Meprin metalloproteases inactivate interleukin 6.
24388959 2014 Association of MEP1A gene variants with insulin metabolism in central European women with polycystic ovary syndrome.
23123160 2012 Meprins process matrix metalloproteinase-9 (MMP-9)/gelatinase B and enhance the activation kinetics by MMP-3.
22923609 2012 Meprin? transactivates the epidermal growth factor receptor (EGFR) via ligand shedding, thereby enhancing colorectal cancer cell proliferation and migration.
22326557 2012 TNF-?-induced down-regulation of CDX2 suppresses MEP1A expression in colitis.
22096485 2011 Enhanced activity of meprin-?, a pro-migratory and pro-angiogenic protease, in colorectal cancer.
20806899 2010 Fetuin-A and cystatin C are endogenous inhibitors of human meprin metalloproteases.
20631730 2010 Processing of procollagen III by meprins: new players in extracellular matrix assembly?
19262505 2009 MEP1A allele for meprin A metalloprotease is a susceptibility gene for inflammatory bowel disease.
17976009 2007 Human and mouse homo-oligomeric meprin A metalloendopeptidase: substrate and inhibitor specificities.
17195012 2007 The alpha and beta subunits of the metalloprotease meprin are expressed in separate layers of human epidermis, revealing different functions in keratinocyte proliferation and differentiation.
16378686 2006 Exclusion of the juvenile myoclonic epilepsy gene EFHC1 as the cause of migraine on chromosome 6, but association to two rare polymorphisms in MEP1A and RHAG.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12556482 2003 Targeted disruption of the meprin beta gene in mice leads to underrepresentation of knockout mice and changes in renal gene expression profiles.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12189145 2002 Activation of human meprin-alpha in a cell culture model of colorectal cancer is triggered by the plasminogen-activating system.
11487543 2001 Intestinal epithelial cells secrete exosome-like vesicles.
11301339 2001 Multimeric structure of the secreted meprin A metalloproteinase and characterization of the functional protomer.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
11267665 2001 Developmental expression of meprin metalloprotease subunits in ICR and C3H/He mouse kidney and intestine in the embryo, postnatally and after weaning.
10898933 2000 Structure and expression of the human MEP1A gene encoding the alpha subunit of metalloendopeptidase meprin A.
10620696 2000 Heterologously overexpressed, affinity-purified human meprin alpha is functionally active and cleaves components of the basement membrane in vitro.
10348167 1999 Composition of the peptide fraction in human blood plasma: database of circulating human peptides.
9914532 1999 Secretion of human meprin from intestinal epithelial cells depends on differential expression of the alpha and beta subunits.
9288916 1997 Polarised expression of human intestinal N-benzoyl-L-tyrosyl-p-aminobenzoic acid hydrolase (human meprin) alpha and beta subunits in Madin-Darby canine kidney cells.
8760356 1996 Identification of the cysteine residues implicated in the formation of alpha 2 and alpha/beta dimers of rat meprin.
8660687 1996 Expression and distribution of meprin protease subunits in mouse intestine.
8262185 1993 Cloning of the PABA peptide hydrolase alpha subunit (PPH alpha) from human small intestine and its expression in COS-1 cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8063866 1994 An old enzyme with a new function: purification and characterization of a distinct matrix-degrading metalloproteinase in rat kidney cortex and its identification as meprin.
7774936 1995 The structural genes, MEP1A and MEP1B, for the alpha and beta subunits of the metalloendopeptidase meprin map to human chromosomes 6p and 18q, respectively.
7340337 1981 Action of rat liver cathepsin L on glucagon.
1939172 1991 The astacin family of metalloendopeptidases.