Property Summary

NCBI Gene PubMed Count 21
PubMed Score 109.37
PubTator Score 15.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Protein-protein Interaction (7)

Gene RIF (11)

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI      1 - 70
TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT     71 - 140
AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY    141 - 210
RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR    211 - 280
NWQDSSVSYAAGALTVH                                                         281 - 297
//

Text Mined References (24)

PMID Year Title