Property Summary

NCBI Gene PubMed Count 18
PubMed Score 100.67
PubTator Score 15.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q9Y316 B4DLS0 D6W575 Q5R2V8 Q5R2V9 Q6NSL5
Symbols MEMO
C2orf4
CGI-27
NS5ATP7

Gene

PDB

3BCZ   3BD0  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (8)

PMID Text
24917593 Biochemical assays revealed that Memo is a copper-dependent redox enzyme that promoted a more oxidized intracellular milieu and stimulated the production of reactive oxygen species (ROS) in cellular structures involved in migration.
23861392 Mediator of ERBB2-driven cell motility (MEMO) promotes extranuclear estrogen receptor signaling involving the growth factor receptors IGF1R and ERBB2.
22824790 MEMO1 is involved in breast carcinogenesis via regulating insulin-like growth factor-I receptor-dependent signaling events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223396 Memo was detected in complexes with cofilin, ErbB2 and PLCgamma1.
18955552 Memo-RhoA-mDia1 signaling coordinates the organization of the lamellipodial actin network, adhesion site formation, and microtubule outgrowth within the cell leading edge to sustain cell motility.
18045866 2.1A crystal structure and homology to class III nonheme iron-dependent dioxygenases
15156151 data suggest that Memo controls cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton [Memo]

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI      1 - 70
TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT     71 - 140
AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY    141 - 210
RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR    211 - 280
NWQDSSVSYAAGALTVH                                                         281 - 297
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24917593 2014 Memo is a copper-dependent redox protein with an essential role in migration and metastasis.
23861392 2013 Mediator of ERBB2-driven cell motility (MEMO) promotes extranuclear estrogen receptor signaling involving the growth factor receptors IGF1R and ERBB2.
22824790 2013 MEMO1, a new IRS1-interacting protein, induces epithelial-mesenchymal transition in mammary epithelial cells.
21840311 2011 MEMO associated with an ErbB2 receptor phosphopeptide reveals a new phosphotyrosine motif.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20937854 2010 ErbB2 receptor controls microtubule capture by recruiting ACF7 to the plasma membrane of migrating cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19223396 2009 Memo is a cofilin-interacting protein that influences PLCgamma1 and cofilin activities, and is essential for maintaining directionality during ErbB2-induced tumor-cell migration.
18955552 2008 Memo-RhoA-mDia1 signaling controls microtubules, the actin network, and adhesion site formation in migrating cells.
18045866 2008 Memo is homologous to nonheme iron dioxygenases and binds an ErbB2-derived phosphopeptide in its vestigial active site.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15156151 2004 Memo mediates ErbB2-driven cell motility.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.