Property Summary

NCBI Gene PubMed Count 45
PubMed Score 89.69
PubTator Score 266.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 2.053 3.6e-02
medulloblastoma -1.100 1.9e-04
medulloblastoma, large-cell -1.400 1.5e-03
pancreatic ductal adenocarcinoma liver m... 2.041 1.4e-02
tuberculosis -1.700 5.3e-06
non-small cell lung cancer 2.363 1.5e-17
intraductal papillary-mucinous neoplasm ... 1.800 2.9e-03
pancreatic cancer 1.100 8.1e-04
lung adenocarcinoma 2.500 7.9e-08
psoriasis -1.300 1.8e-06
Breast cancer -1.800 2.9e-08
ovarian cancer 2.500 4.3e-06

 GO Function (1)

Gene RIF (16)

PMID Text
25216327 Melanotransferrin is a serological marker of colorectal cancer by secretome analysis and quantitative proteomics.
21190562 PC3 tumors are sustained by a small number of tumor-initiating cells with stem-like characteristics, including strong self-renewal and pro-angiogenic capability and marked by the expression pattern FAM65Bhigh/MFI2low/LEF1low.
18691669 Biochemical and spectroscopic studies of MTF1 are reported.
17570828 results suggest a Plg-mediated internalization mechanism for the clearance of sMTf via annexin II and LRP
17452986 this review discusses the studies that have demonstrated that melanotransferrin is not involved in iron metabolism, but plays a vital role in melanoma cell proliferation and tumorigenesis.
17449903 Novel molecular targets directly or indirectly regulated by MTf and the potential pathways involved in its function, including modulation of proliferation.
17227112 HMB-45 (melanoma-associated antigen p97) and Melan-A combined were positive in 100% of the renal angiomyolipomas
17196552 Altogether, these findings strongly suggest that MTf overexpression in melanoma cells contributes to tumor progression by stimulating plasmin generation as well as cell migration and invasion.
16713448 Anti-angiogenic properties of soluble melanotransferrin may result from local overstimulation of plasminogen activation by tissue plasminogen activator, thus leading to subsequent degradation of the fibronectin matrix and endothelial cell detachment.
16704991 melanotransferrin has a role in cell proliferation and tumorigenesis
15716025 The distribution of MTf and its splice variants may provide clues to their possible biological roles in melanoma and other tumors.
12809550 Serum melanotransferrin exists in various conformations depending on the binding of bivalent cations or following post-translational modification; serum melanotransferrin levels are unchanged in subjects with Alzheimer's disease.
12750156 membrane-bound and soluble p97 affect the migration capacity of endothelial and melanoma cells and suggest that p97 could be involved in the regulation of plasminogen activation by interacting with pro-uPA and plasminogen.
12710945 This melanoma-associated marker was detected in melanoma cell lines.
12230555 its ability to donate 59Fe to SK-Mel-28 melanoma cells and other cell types
11852110 The human genome contains a second melanotransferrin gene (MTf2). There are two isoforms of melanotransferrin.

AA Sequence

MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ      1 - 70
EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW     71 - 140
NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDY    141 - 210
SGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHA    211 - 280
VVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLH    281 - 350
AMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL    351 - 420
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPV    421 - 490
GALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAF    491 - 560
RCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVR    561 - 630
PDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAA    631 - 700
LEGMSSQQCSGAAAPAPGAPLLPLLLPALAARLLPPAL                                    701 - 738
//

Text Mined References (48)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25416956 2014 A proteome-scale map of the human interactome network.
25216327 2014 Discovery of melanotransferrin as a serological marker of colorectal cancer by secretome analysis and quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21190562 2010 PC3 prostate tumor-initiating cells with molecular profile FAM65Bhigh/MFI2low/LEF1low increase tumor angiogenesis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19815549 2009 Meckel-Gruber syndrome protein MKS3 is required for endoplasmic reticulum-associated degradation of surfactant protein C.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691669 2008 Biochemical and spectroscopic studies of human melanotransferrin (MTf): electron-paramagnetic resonance evidence for a difference between the iron-binding site of MTf and other transferrins.
17570828 2007 Plasminogen-dependent internalization of soluble melanotransferrin involves the low-density lipoprotein receptor-related protein and annexin II.
17452986 2007 The melanoma tumor antigen, melanotransferrin (p97): a 25-year hallmark--from iron metabolism to tumorigenesis.
17449903 2007 Identification of distinct changes in gene expression after modulation of melanoma tumor antigen p97 (melanotransferrin) in multiple models in vitro and in vivo.
17227112 2007 Differential expression of melanocytic markers in myoid, lipomatous, and vascular components of renal angiomyolipomas.
17196552 2007 Melanotransferrin induces human melanoma SK-Mel-28 cell invasion in vivo.
16713448 2006 Melanotransferrin stimulates t-PA-dependent activation of plasminogen in endothelial cells leading to cell detachment.
16704991 2006 The function of melanotransferrin: a role in melanoma cell proliferation and tumorigenesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16449195 2006 Localized recruitment and activation of RhoA underlies dendritic spine morphology in a glutamate receptor-dependent manner.
16449192 2006 P21-activated kinase 1: convergence point in PDGF- and LPA-stimulated collagen matrix contraction by human fibroblasts.
16449191 2006 AP-2alpha: a regulator of EGF receptor signaling and proliferation in skin epidermis.
15716025 2005 Examination of the distribution of the transferrin homologue, melanotransferrin (tumour antigen p97), in mouse and human.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12860420 2003 The double-edged nature of using genetic databases: melanotransferrin genes and transcripts.
12809550 2003 Expression of melanotransferrin isoforms in human serum: relevance to Alzheimer's disease.
12750156 2003 Regulation of plasminogen activation: a role for melanotransferrin (p97) in cell migration.
12710945 2003 Detection of multiple melanoma-associated markers in melanoma cell lines by RT in situ PCR.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230555 2002 The soluble form of the membrane-bound transferrin homologue, melanotransferrin, inefficiently donates iron to cells via nonspecific internalization and degradation of the protein.
11852110 2002 A second melanotransferrin gene (MTf2) and a novel protein isoform: explanation for the membrane-bound and soluble forms of melanotransferrin?
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10691965 2000 The role of the membrane-bound tumour antigen, melanotransferrin (p97), in iron uptake by the human malignant melanoma cell.
9176405 1997 Molecular detection of tumor-associated antigens shared by human cutaneous melanomas and gliomas.
8705293 1996 Coincident expression and distribution of melanotransferrin and transferrin receptor in human brain capillary endothelium.
8300636 1994 Transport and expression in human melanomas of a transferrin-like glycosylphosphatidylinositol-anchored protein.
7556058 1995 A novel iron uptake mechanism mediated by GPI-anchored human p97.
6843660 1983 Assignment of the gene for human melanoma-associated antigen p97 to chromosome 3.
3754536 1986 Chromosomal sublocalization of the human p97 melanoma antigen.
3010712 1986 The p97 antigen is mapped to the q24-qter region of chromosome 3; the same region as the transferrin receptor.
2540389 1989 In situ localization of melanotransferrin (melanoma-associated antigen P97) in human liver. A light- and electronmicroscopic immunohistochemical study.
2463331 1989 A unique antigenic epitope of human melanoma is carried on the common melanoma glycoprotein gp95/p97.
2419904 1986 Primary structure of the human melanoma-associated antigen p97 (melanotransferrin) deduced from the mRNA sequence.
1633859 1992 A molecular model for the tumour-associated antigen, p97, suggests a Zn-binding function.
1544447 1992 Human melanotransferrin (p97) has only one functional iron-binding site.