Property Summary

Ligand Count 620
NCBI Gene PubMed Count 44
PubMed Score 88.41
PubTator Score 54.97

Knowledge Summary

Patent (25,749)

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 2.637 5.0e-05
adult high grade glioma 2.500 1.7e-05
Atopic dermatitis 1.500 2.9e-05
atypical teratoid / rhabdoid tumor 3.500 3.9e-13
Breast cancer 3.400 3.7e-25
breast carcinoma 1.900 2.7e-39
colon cancer 1.900 4.1e-04
ductal carcinoma in situ 2.300 2.1e-03
Endometriosis 1.627 7.3e-03
ependymoma 1.500 2.6e-05
glioblastoma 3.200 6.2e-11
group 3 medulloblastoma 3.700 1.6e-09
interstitial cystitis 1.400 2.2e-02
intraductal papillary-mucinous carcinoma... 3.500 1.6e-04
intraductal papillary-mucinous neoplasm ... 4.500 6.2e-04
invasive ductal carcinoma 2.700 8.6e-04
lung adenocarcinoma 1.300 4.9e-09
lung cancer 2.200 3.0e-04
malignant mesothelioma 1.500 5.6e-07
medulloblastoma, large-cell 3.000 1.0e-06
nasopharyngeal carcinoma 1.400 1.1e-04
non-small cell lung cancer 3.422 1.3e-37
ovarian cancer 2.100 7.7e-05
pancreatic cancer 1.600 4.2e-06
primitive neuroectodermal tumor 3.100 5.3e-06
psoriasis 1.500 7.9e-08

PDB (18)

Gene RIF (30)

AA Sequence

MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHIC      1 - 70
QLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLF     71 - 140
DEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFD    141 - 210
DDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFI    211 - 280
HLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDI    281 - 350
KSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL    351 - 420
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTD    421 - 490
KLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLH    491 - 560
YNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQR    561 - 630
LKGDAWVYKRLVEDILSSCKV                                                     631 - 651
//

Text Mined References (57)

PMID Year Title