Property Summary

NCBI Gene PubMed Count 91
PubMed Score 130.43
PubTator Score 96.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
hepatocellular carcinoma 1.300 1.5e-03
pancreatic cancer 1.700 2.6e-03
malignant mesothelioma -3.700 2.0e-08
astrocytic glioma -1.100 1.7e-02
psoriasis -1.300 3.3e-03
osteosarcoma -1.136 2.9e-02
posterior fossa group B ependymoma 2.300 3.6e-10
glioblastoma 1.300 5.6e-03
medulloblastoma, large-cell 1.400 1.9e-02
intraductal papillary-mucinous carcinoma... -2.100 3.4e-02
lung cancer -2.100 7.8e-04
colon cancer -2.800 1.9e-02
lung adenocarcinoma -1.400 3.5e-13
pediatric high grade glioma 1.100 1.0e-02
sonic hedgehog group medulloblastoma 2.000 1.2e-04
pancreatic carcinoma 1.700 2.6e-03
aldosterone-producing adenoma -1.236 1.8e-02
subependymal giant cell astrocytoma -2.344 2.9e-03
lung carcinoma -1.700 1.6e-12
non-small cell lung carcinoma -1.200 5.8e-16
spina bifida -1.721 3.7e-02
invasive ductal carcinoma -1.200 6.1e-03
ovarian cancer 1.500 1.2e-03

Gene RIF (65)

PMID Text
26747896 Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML.
26498236 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort.
26206755 It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20.
26130510 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein.
26059450 HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias.
25740828 Data indicate that Meis homeobox 1 (MEIS1) knockdown by lentiviral-shRNA significantly inhibited the growth in leukemia cell lines.
25585874 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
25107888 MEIS1 expression induces lineage commitment towards a megakaryocyte-erythroid progenitor cell fate in common myeloid progenitor cells through activation of genes that define a megakaryocyte-erythroid-specific gene expression program.
24995868 data link MEIS1 loss of function to the etiopathology of RLS, highlight how combined sequencing and systematic functional annotation of rare variation at GWAS loci can detect risk burden
24985084 MEIS1 is likely a key mediator between sex steroid and genes for uterine receptivity. Diminished endometrium MEIS1 expression may contribute to implantation failure in endometriosis.
24617557 statistically significantly lower expression of miR-204 in all nephroblastomas investigated might point to an involvement of miR-204 in the regulation of MEIS1 in nephroblastomas
24244575 BRAF p.V600E colon tumors showed significant MEIS1 promoter methylation, which was associated with decreased MEIS1 gene expression.
24022755 MEIS1 in hematopoiesis and contributes to its aberrant expression in acute leukemia
23868827 [review] It is possible that Meis1 contributes to the quiescent state of adult cardiomyocytes by regulating redox homeostasis.
23660297 Hoxa7, Hoxa9 and Hox cofactor Meis1 were identified as AP-2alpha target genes, which are involved in myeloid leukemogenesis.
22972982 Data indicate that dynamin 3 (DNM3) harbors MEIS1 binding sites and is associated with differences in mean platelet volume (MPV).
22353710 findings show that HOXA9 and MEIS1 are direct targets of miRNA-196b, a microRNA located adjacent to and co-expressed with HOXA9, in MLL-rearranged leukaemic cells
22185299 up-regulation of MEIS1 is important for sustaining proliferation of leukemic cells and that down-regulation of MEIS1
21986840 the cellular context in which HOX/MEIS1 is overexpressed appears to be very important, and other relevant genes are most likely required as well to maintain the expanding capacity of the CD34thorn NPMcthorn acute myeloid leukemia cells
21925394 Variants in MEIS1, BTBD9, and MAP2K5/SKOR1 confer a significant risk of restless legs syndrome in a United States population.
21858198 Data show that MEIS1D, a Meis1 isoform, is expressed in colon.
21710629 A link is established between the restless legs syndrome-associated MEIS1 gene and iron metabolism.
21703237 These findings indicate that Meis1 works as a transcription factor for mitochondrial genes in pancreatic cancer cells.
21572129 In the German sample, variants in MEIS1 and BTBD9 were associated with Restless legs syndrome in end stage renal disease
21518888 Several targets of MLL fusions, MEIS1, HOXA7, HOXA9, and HOXA10 are functionally related and have been implicated in leukemias. Each of the four genes was knocked down separately in the precursor B-cell leukemic line RS4;11 expressing MLL-AF4.
21422461 Screening of the coding regions of MEIS1 in patients with RLS revealed 3 novel variants.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600580 ETS transcription factor ELF1 is an important positive regulator of MEIS1 expression
20541704 GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation.
20396431 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20062060 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822783 Observational study of gene-disease association. (HuGE Navigator)
19799567 Data demonstrated that overexpressed PBX1 and MEIS1 increased endogenous SOX3 protein expression in both uninduced and RA-induced NT2/D1 cells.
19776672 MEIS1 may be a useful tumor marker for favorable prognosis in breast cancer.
19620614 We report a MEIS1 p.R272H mutation in familial restless legs syndrome.
19620287 CREB1 may mediate HOXA9 modulation of Meis1 expression.
19563517 combination of low HOXA4 and low MEIS1 gene expression is a favourable predictor for outcome in all AML patients and that the expression levels are governed by the methylation state of these genes.
19559479 co-operation between TLX1 and MEIS proteins may have a significant role in T-cell leukemogenesis.
19473990 MEIS1A transactivation in response to protein kinase A signaling requires the transducers of regulated CREB family of CREB co-activators
19279021 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19223043 From the result of this study suggested there was no evidence for an over-transmission of the at-risk haplotype in MEIS1 (G-A-G, 51 transmissions versus 59 non-transmissions, nominal p-value = 0.381).
19223043 Observational study of gene-disease association. (HuGE Navigator)
19126776 Reduced expression of the MEIS1 gene, possibly through intronic cis-regulatory element(s), predisposes to restless legs syndrome.
19126776 Observational study of gene-disease association. (HuGE Navigator)
19109563 results show that MEIS1 expression is important for MLL-rearranged leukemias and suggest that MEIS1 promotes cell-cycle entry
18973687 co-expression of PBX1 and MEIS1/2 in granulosa cells in normal human ovaries suggested that MEIS1/2 might control PBX1 sublocalization, as seen in other systems
18541116 MEIS1 and LBXCOR1 are developmental factors and raise new pathophysiologic questions for RLS.
18410541 analysis of the role of deregulated PcG genes in acute myeloid leukemia, and the downstream PcG targets HOXA4, HOXA9 and MEIS1
18216367 MEIS1 polymorphism is associated with Nocturnal Myoclonus Syndrome.
18195096 MLL-FRYL did not increase MEIS1 expression, conferred a proliferative advantage without altering differentiation, and had protracted latency to disease.
17805329 In CREB-overexpressing control cells, Meis1 RNA expression was 3-fold higher than in untransfected cells. In AML cells, it was 5- to 10-fold higher than in the control cells. Persistent Meis1 expression may cause leukemia.
17637780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16172981 pre B-cell leukemia transcription factor 1 is mostly cytoplasmic in epithelial endometrial cells of the developing female genital tract despite the nuclear localization of MEIS1
15681849 CYBB is a common target gene repressed by HoxA10 and activated by HoxA9, and Meis1 and Nup98-hoxA9 have roles in repressing myeloid-specific gene transcription
15654074 MEIS C termini possess transcriptional regulatory domains that respond to cell signaling and confer functional differences between MEIS and PREP proteins
15479723 advantage to Meis1-HoxA9 coexpressing cells in vivo, leading to leukemogenesis.
15160920 suggest that MLL aberrations may regulate MEIS1 and HOXA9 gene expression in ALL-derived cell lines, while AML-derived cell lines express these genes independently of the MLL status
15103390 found a constant downregulation of the Meis 1 gene mRNA in AML1-ETO acute myeloid leukemias and in those cases harboring in frame mutations in the bZIP domain of CEBPalpha
14966272 Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction.
14701735 Hoxa9 and Hoxa7 as well as the Hox coregulators Meis1 and Pbx3 among the targets upregulated by MLL-ENL-ERtm in conditionally transformed cells
12609849 these studies demonstrate that the homeodomain proteins, MEIS1, PBX1B, and PBX2, play an important role in megakaryocytic gene expression

AA Sequence

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDA      1 - 70
LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPE     71 - 140
LDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQ    141 - 210
PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFP    211 - 280
KVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP    281 - 350
DGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM                                  351 - 390
//

Text Mined References (94)

PMID Year Title
26747896 2016 PBX3 and MEIS1 Cooperate in Hematopoietic Cells to Drive Acute Myeloid Leukemias Characterized by a Core Transcriptome of the MLL-Rearranged Disease.
26498236 2015 Genetic associations of periodic limb movements of sleep in the elderly for the MrOS sleep study.
26206755 2015 RE-IIBP Methylates H3K79 and Induces MEIS1-mediated Apoptosis via H2BK120 Ubiquitination by RNF20.
26130510 2015 Dangerous liaisons: cooperation between Pbx3, Meis1 and Hoxa9 in leukemia.
26059450 2015 HOXA9 and MEIS1 gene overexpression in the diagnosis of childhood acute leukemias: Significant correlation with relapse and overall survival.
25740828 2015 MEIS1 regulates an HLF-oxidative stress axis in MLL-fusion gene leukemia.
25585874 2015 Promoter DNA methylation and expression levels of HOXA4, HOXA5 and MEIS1 in acute myeloid leukemia.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
25107888 2014 MEIS1 regulates early erythroid and megakaryocytic cell fate.
24995868 2014 Targeted resequencing and systematic in vivo functional testing identifies rare variants in MEIS1 as significant contributors to restless legs syndrome.
24985084 2014 Regulation of myeloid ecotropic viral integration site 1 and its expression in normal and abnormal endometrium.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24617557 Nephroblastomas show low expression of microR-204 and high expression of its target, the oncogenic transcription factor MEIS1.
24244575 2013 The homeobox gene MEIS1 is methylated in BRAF (p.V600E) mutated colon tumors.
24022755 2014 Regulation of MEIS1 by distal enhancer elements in acute leukemia.
23868827 2013 An unexpected switch: regulation of cardiomyocyte proliferation by the homeobox gene meis1.
23660297 2013 Transcription factor AP-2? regulates acute myeloid leukemia cell proliferation by influencing Hoxa gene expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139255 2012 Novel loci associated with PR interval in a genome-wide association study of 10 African American cohorts.
22972982 2012 A GWAS sequence variant for platelet volume marks an alternative DNM3 promoter in megakaryocytes near a MEIS1 binding site.
22353710 2012 miR-196b directly targets both HOXA9/MEIS1 oncogenes and FAS tumour suppressor in MLL-rearranged leukaemia.
22185299 2011 MEIS1, PREP1, and PBX4 are differentially expressed in acute lymphoblastic leukemia: association of MEIS1 expression with higher proliferation and chemotherapy resistance.
21986840 2012 Downregulation of MEIS1 impairs long-term expansion of CD34+ NPM1-mutated acute myeloid leukemia cells.
21925394 2011 Association studies of variants in MEIS1, BTBD9, and MAP2K5/SKOR1 with restless legs syndrome in a US population.
21858198 2011 A conserved tissue-specific homeodomain-less isoform of MEIS1 is downregulated in colorectal cancer.
21779176 2011 Genome-wide association study identifies novel restless legs syndrome susceptibility loci on 2p14 and 16q12.1.
21710629 2011 Restless legs syndrome-associated MEIS1 risk variant influences iron homeostasis.
21703237 2011 Role of Meis1 in mitochondrial gene transcription of pancreatic cancer cells.
21572129 2011 MEIS1 and BTBD9: genetic association with restless leg syndrome in end stage renal disease.
21518888 2011 Down-regulation of homeobox genes MEIS1 and HOXA in MLL-rearranged acute leukemia impairs engraftment and reduces proliferation.
21422461 2011 Variant screening of the coding regions of MEIS1 in patients with restless legs syndrome.
21347284 2011 Genome-wide association studies of the PR interval in African Americans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600580 2010 Identification of E74-like factor 1 (ELF1) as a transcriptional regulator of the Hox cofactor MEIS1.
20541704 2010 GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis.
20396431 2010 Genotyping sleep disorders patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20159610 2010 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia.
20062060 2010 Genome-wide association study of PR interval.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822783 2009 Association of intronic variants of the BTBD9 gene with Tourette syndrome.
19799567 2009 PBX1 and MEIS1 up-regulate SOX3 gene expression by direct interaction with a consensus binding site within the basal promoter region.
19776672 2009 TMEM25, REPS2 and Meis 1: favourable prognostic and predictive biomarkers for breast cancer.
19620614 2009 MEIS1 p.R272H in familial restless legs syndrome.
19620287 2009 HOXA9 modulates its oncogenic partner Meis1 to influence normal hematopoiesis.
19563517 2009 The combined expression of HOXA4 and MEIS1 is an independent prognostic factor in patients with AML.
19559479 2010 MEIS proteins as partners of the TLX1/HOX11 oncoprotein.
19473990 2009 Transcriptional activation by MEIS1A in response to protein kinase A signaling requires the transducers of regulated CREB family of CREB co-activators.
19279021 2009 Replication of restless legs syndrome loci in three European populations.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19223043 2009 Exploring the genetic link between RLS and ADHD.
19126776 2009 MEIS1 intronic risk haplotype associated with restless legs syndrome affects its mRNA and protein expression levels.
19109563 2009 A role for MEIS1 in MLL-fusion gene leukemia.
18973687 2008 HOX cofactors expression and regulation in the human ovary.
18692240 2009 Physical and functional interactions between hematopoietic cell-specific ETS transcription factors and homeodomain proteins.
18541116 2008 Genetics of restless legs syndrome.
18410541 2008 Gene expression profiling of Polycomb, Hox and Meis genes in patients with acute myeloid leukaemia.
18216367 2008 A genetic risk factor for periodic limb movements in sleep.
18195096 2008 Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome.
17805329 2008 CREB regulates Meis1 expression in normal and malignant hematopoietic cells.
17637780 2007 Genome-wide association study of restless legs syndrome identifies common variants in three genomic regions.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16172981 2005 PBX1 intracellular localization is independent of MEIS1 in epithelial cells of the developing female genital tract.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15681849 2005 HOXA9 activates transcription of the gene encoding gp91Phox during myeloid differentiation.
15654074 2005 MEIS C termini harbor transcriptional activation domains that respond to cell signaling.
15617687 2005 Range of HOX/TALE superclass associations and protein domain requirements for HOXA13:MEIS interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479723 2005 Meis1-mediated apoptosis is caspase dependent and can be suppressed by coexpression of HoxA9 in murine and human cell lines.
15466398 2004 Pbx3 deficiency results in central hypoventilation.
15161102 2004 A conserved non-homeodomain Hoxa9 isoform interacting with CBP is co-expressed with the 'typical' Hoxa9 protein during embryogenesis.
15160920 2004 Expression of HOX genes in acute leukemia cell lines with and without MLL translocations.
15103390 2004 MEIS 1 expression is downregulated through promoter hypermethylation in AML1-ETO acute myeloid leukemias.
14966272 2004 Differential and common leukemogenic potentials of multiple NUP98-Hox fusion proteins alone or with Meis1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701735 2004 Hoxa9 and Meis1 are key targets for MLL-ENL-mediated cellular immortalization.
12609849 2003 Homeodomain proteins MEIS1 and PBXs regulate the lineage-specific transcription of the platelet factor 4 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342305 2000 TALE homeoproteins as HOX11-interacting partners in T-cell leukemia.
11331288 2001 The homeodomain proteins PBX and MEIS1 are accessory factors that enhance thyroid hormone regulation of the malic enzyme gene in hepatocytes.
11161815 2001 The MEIS1 oncogene is highly expressed in neuroblastoma and amplified in cell line IMR32.
10523646 1999 PBX and MEIS as non-DNA-binding partners in trimeric complexes with HOX proteins.
10471746 1999 A conserved motif N-terminal to the DNA-binding domains of myogenic bHLH transcription factors mediates cooperative DNA binding with pbx-Meis1/Prep1.
10373562 1999 Trimeric association of Hox and TALE homeodomain proteins mediates Hoxb2 hindbrain enhancer activity.
10082572 1999 HOXA9 forms triple complexes with PBX2 and MEIS1 in myeloid cells.
9847074 1998 Toward a complete human genome sequence.
9405651 1997 Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an interaction surface disrupted in oncoprotein E2a-Pbx1.
9343407 1997 AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins.
9226379 1997 Cloning and mapping of the MEIS1 gene, the human homolog of a murine leukemogenic gene.
9049632 1997 Identification of a conserved family of Meis1-related homeobox genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7565694 1995 Meis1, a PBX1-related homeobox gene involved in myeloid leukemia in BXH-2 mice.