Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 8.6e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 8.6e-03

Gene RIF (3)

PMID Text
24240703 MEIOB interacts with RPA and SPATA22.
24068956 we propose that RPA and this new single-strand DNA binding protein MEIOB, are essential to ensure the proper stabilization of recombinases which is required for successful homology search and meiotic recombination.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MANSFAARIFTTLSDLQTNMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASWGN      1 - 70
EDYIKSLSDSFRVGDCVIIENPLIQRKEIEREEKFSPATPSNCKLLLSENHSTVKVCSSYEVDTKLLSLI     71 - 140
HLPVKESHDYYSLGDIVANGHSLNGRIINVLAAVKSVGEPKYFTTSDRRKGQRCEVRLYDETESSFAMTC    141 - 210
WDNESILLAQSWMPRETVIFASDVRINFDKFRNCMTATVISKTIITTNPDIPEANILLNFIRENKETNVL    211 - 280
DDEIDSYFKESINLSTIVDVYTVEQLKGKALKNEGKADPSYGILYAYISTLNIDDETTKVVRNRCSSCGY    281 - 350
IVNEASNMCTTCNKNSLDFKSVFLSFHVLIDLTDHTGTLHSCSLTGSVAEETLGCTFVLSHRARSGLKIS    351 - 420
VLSCKLADPTEASRNLSGQKHV                                                    421 - 442
//

Text Mined References (7)

PMID Year Title
24240703 2013 MEIOB exhibits single-stranded DNA-binding and exonuclease activities and is essential for meiotic recombination.
24068956 2013 MEIOB targets single-strand DNA and is necessary for meiotic recombination.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.