Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.74
PubTator Score 2.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.8e-06
Disease Target Count Z-score Confidence
Premature ovarian failure 65 3.688 1.8
Amenorrhea 58 3.619 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 1.8e-06

AA Sequence

MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYN      1 - 70
KQRECDDKEVHKVKIYAY                                                         71 - 88
//

Text Mined References (4)

PMID Year Title