Property Summary

NCBI Gene PubMed Count 67
PubMed Score 88.64
PubTator Score 41.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Migraine without Aura 11 0.0 0.0
Disease Target Count
Common Migraine 7
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Migraine 83 0.0 3.0
Disease Target Count Z-score Confidence
Parkinson's disease 392 3.419 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 4.5e-05
atypical teratoid / rhabdoid tumor -1.500 9.0e-09
ependymoma -1.200 2.6e-12
glioblastoma -1.200 2.0e-09
medulloblastoma -1.100 8.4e-05
medulloblastoma, large-cell 1.100 1.5e-03
ovarian cancer -1.200 3.5e-07
primitive neuroectodermal tumor -1.300 7.7e-06

Protein-protein Interaction (1)

Gene RIF (37)

AA Sequence

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNF     71 - 140
AMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDL    141 - 210
NSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKG    211 - 280
LMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF    281 - 350
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP    351 - 420
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDF    421 - 490
GPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK                                           491 - 521
//

Text Mined References (80)

PMID Year Title