Property Summary

NCBI Gene PubMed Count 56
PubMed Score 79.11
PubTator Score 41.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 2.6e-12
glioblastoma -1.400 4.8e-08
atypical teratoid / rhabdoid tumor -1.500 9.0e-09
sonic hedgehog group medulloblastoma -1.200 2.7e-05
medulloblastoma, large-cell 1.100 1.5e-03
primitive neuroectodermal tumor -1.300 7.7e-06
adult high grade glioma -1.600 2.1e-05
ovarian cancer -1.200 3.5e-07

Protein-protein Interaction (1)

Gene RIF (26)

PMID Text
26355845 miR-1244 and MEF2D form an autoregulatory loop contributing to the progression of lung carcinoma.
26164003 MEF2D was also found to increase the transcription of Pokemon by binding myocyte enhancer factor 2 (MEF2) sites within its promoter region, that can promote Hepatocellular carcinoma invasion
25814384 MEF2D suppression was shown to decrease the proliferation of osteosarcoma cells.
25812649 Cell cycle progression was also inhibited by MEF2D suppression.
25733682 MEF2C and MEF2D interact with the E3 ligase F-box protein SKP2, which mediates their subsequent degradation through the ubiquitin-proteasome system.
25472877 OA induced cell cycle arrest in lung cancer cells through miR-122/Cyclin G1/MEF2D pathway. This finding may contribute to the understanding of the molecular mechanism of OA's anti-tumor activity
24390737 MEF2D-silencing abolished hepatocellular carcinoma tumorigenicity.
24279793 The oncogenic properties of rhabdomyosarcoma cells can be partially attributed to the loss of MEF2D expression.
24219011 Oxidation of survival factor MEF2D inhibits its function, underlies oxidative stress-induced neurotoxicity, and may be a part of the Parkinson disease pathogenic process.
22256741 The expression of MEF2D was higher in the higher clinical stage of nasopharyngeal carcinoma, but there was no correlation with survival rate.
21393861 direct regulation of complex I by mitochondrial MEF2D underlies its neuroprotective effects, and dysregulation of this pathway may contribute to Parkinson disease
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20590529 MEF2A and MEF2D play dual roles in human macrophages differentiation, as activators and as repressors of c-jun transcription.
20363751 ZAC1 is a novel and previously unknown regulator of cardiomyocyte Glut4 expression and glucose uptake; MEF2 is a regulator of ZAC1 expression in response to induction of hypertrophy
20198315 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19119233 MEF2D levels were increased in the brains patients with Parkinson's disease
19093215 MEF2 proteins are an important component in Galpha13-mediated angiogenesis.
18660489 Observational study of gene-disease association. (HuGE Navigator)
17158926 These results reveal an unexpected role for HDAC3 and suggest a novel pathway through which MEF2 activity is controlled in vivo.
16166628 histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications regulate MEF2
15834131 A conserved pattern of alternative splicing in vertebrate MEF2 (myocyte enhancer factor 2) genes generates an acidic activation domain in MEF2 proteins selectively in tissues where MEF2 target genes are highly expressed. (MEF2)
15744350 data implicate MEF2D in human cancer and suggest that MEF2D/DAZAP1 and/or DAZAP1/MEF2D contribute to leukemogenesis by altering signaling pathways normally regulated by wild-type MEF2D and DAZAP1

AA Sequence

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNF     71 - 140
AMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDL    141 - 210
NSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKG    211 - 280
LMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF    281 - 350
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP    351 - 420
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDF    421 - 490
GPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK                                           491 - 521
//

Text Mined References (69)

PMID Year Title
26355845 2015 miR-1244/Myocyte Enhancer Factor 2D Regulatory Loop Contributes to the Growth of Lung Carcinoma.
26164003 2015 Pokemon and MEF2D co-operationally promote invasion of hepatocellular carcinoma.
25814384 2015 MEF2D overexpression contributes to the progression of osteosarcoma.
25812649 2015 miR-218 suppresses cardiac myxoma proliferation by targeting myocyte enhancer factor 2D.
25733682 2015 The control operated by the cell cycle machinery on MEF2 stability contributes to the downregulation of CDKN1A and entry into S phase.
25472877 2015 Oleanolic acid suppresses the proliferation of lung carcinoma cells by miR-122/Cyclin G1/MEF2D axis.
24390737 2014 Overexpression of the transcription factor MEF2D in hepatocellular carcinoma sustains malignant character by suppressing G2-M transition genes.
24279793 2013 Loss of MEF2D expression inhibits differentiation and contributes to oncogenesis in rhabdomyosarcoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24219011 2014 Oxidation of survival factor MEF2D in neuronal death and Parkinson's disease.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22256741 2011 [Expression of MEF2D on nasopharyngeal carcinoma tissues and its influence of prognostic].
21393861 2011 Direct regulation of complex I by mitochondrial MEF2D is disrupted in a mouse model of Parkinson disease and in human patients.
21269460 2011 Initial characterization of the human central proteome.
21030595 2010 HDAC3 is negatively regulated by the nuclear protein DBC1.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20590529 2010 Dual roles for MEF2A and MEF2D during human macrophage terminal differentiation and c-Jun expression.
20363751 2010 Regulation of cardiomyocyte Glut4 expression by ZAC1.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19119233 2009 Regulation of neuronal survival factor MEF2D by chaperone-mediated autophagy.
19093215 2009 Galpha13 regulates MEF2-dependent gene transcription in endothelial cells: role in angiogenesis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17959722 2007 MEF2: a central regulator of diverse developmental programs.
17158926 2007 Histone deacetylase 3 interacts with and deacetylates myocyte enhancer factor 2.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16356933 2006 Control of MEF2 transcriptional activity by coordinated phosphorylation and sumoylation.
16166628 2005 Regulation of MEF2 by histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications.
16043483 2005 MEF2-dependent recruitment of the HAND1 transcription factor results in synergistic activation of target promoters.
15902271 2005 Calmodulin-dependent protein kinase IV regulates nuclear export of Cabin1 during T-cell activation.
15888658 2005 Cyclin-dependent kinase 5 mediates neurotoxin-induced degradation of the transcription factor myocyte enhancer factor 2.
15834131 2005 Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain.
15831463 2005 Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation.
15744350 2005 Cloning and functional characterization of MEF2D/DAZAP1 and DAZAP1/MEF2D fusion proteins created by a variant t(1;19)(q23;p13.3) in acute lymphoblastic leukemia.
15743823 2005 Association with class IIa histone deacetylases upregulates the sumoylation of MEF2 transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12896970 2003 Inactivation of the myocyte enhancer factor-2 repressor histone deacetylase-5 by endogenous Ca(2+) //calmodulin-dependent kinase II promotes depolarization-mediated cerebellar granule neuron survival.
12691662 2003 Cdk5-mediated inhibition of the protective effects of transcription factor MEF2 in neurotoxicity-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213324 2002 Synergistic interaction of MEF2D and Sp1 in activation of the CD14 promoter.
11904443 2002 Dominant-interfering forms of MEF2 generated by caspase cleavage contribute to NMDA-induced neuronal apoptosis.
11433030 2001 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation.
11096067 2001 Control of cardiac-specific transcription by p300 through myocyte enhancer factor-2D.
10944115 2000 Integration of calcineurin and MEF2 signals by the coactivator p300 during T-cell apoptosis.
10849446 2000 Big mitogen-activated kinase regulates multiple members of the MEF2 protein family.
10737771 2000 Signal-dependent activation of the MEF2 transcription factor by dissociation from histone deacetylases.
10617605 2000 Ca(2+)-dependent gene expression mediated by MEF2 transcription factors.
10523670 1999 HDAC4, a human histone deacetylase related to yeast HDA1, is a transcriptional corepressor.
10458488 1999 Expression of MEF2 genes during human cardiac development.
9858528 1999 Regulation of the MEF2 family of transcription factors by p38.
9753748 1998 Interaction of myocyte enhancer factor 2 (MEF2) with a mitogen-activated protein kinase, ERK5/BMK1.
8798771 1996 MEF2 protein expression, DNA binding specificity and complex composition, and transcriptional activity in muscle and non-muscle cells.
8575763 1995 Regional chromosomal assignments for four members of the MADS domain transcription enhancer factor 2 (MEF2) gene family to human chromosomes 15q26, 19p12, 5q14, and 1q12-q23.
8269842 1993 A fourth human MEF2 transcription factor, hMEF2D, is an early marker of the myogenic lineage.