Property Summary

NCBI Gene PubMed Count 118
PubMed Score 315.43
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 3.300 4.5e-04
Multiple myeloma 1.753 8.8e-04
oligodendroglioma -1.100 1.6e-15
ependymoma -1.200 3.6e-09
glioblastoma -1.600 6.2e-04
medulloblastoma -1.500 3.0e-04
atypical teratoid / rhabdoid tumor -2.200 3.3e-06
medulloblastoma, large-cell -2.700 2.0e-06
primitive neuroectodermal tumor -1.300 9.0e-04
acute quadriplegic myopathy 1.020 5.7e-05
intraductal papillary-mucinous carcinoma... 1.100 4.3e-02
lung cancer -1.600 8.5e-05
Breast cancer 2.100 4.0e-02
pediatric high grade glioma -1.200 1.6e-04
subependymal giant cell astrocytoma 1.177 3.4e-02
ovarian cancer -1.800 1.9e-08

Protein-protein Interaction (11)

Gene RIF (86)

PMID Text
26552705 p38 MAPK is a key regulator of canonical Wnt signaling by promoting a phospho-dependent interaction between MEF2 and beta-catenin to enhance cooperative transcriptional activity and cell proliferation.
26421691 The findings of this study are consistent with MEF2A deregulation conferring risk of formal thought disorder.
26400337 Variants in the 3'-UTR of MEF2A are associated with coronary artery disease in a Chinese Han population.
25809782 Mechanistically, MEF-2 was recruited to the viral promoter (LTR, long terminal repeat) in the context of chromatin, and constituted Tax/CREB transcriptional complex via direct binding to the HTLV-1 LTR.
25655189 Our results revealed a link and interaction between MEF2A and miR-143 and suggested a potential mechanism for MEF2A to regulate H(2)O(2) -induced VSMC senescence.
25366733 six or seven amino acid deletions and synonymous mutations (147143G-->A)in exon 11 of the MEF2A gene may be correlated with susceptibility to coronary artery disease in the Chinese population
25336633 MEF2 is the key cis-acting factor that regulates expression of a number of transcriptional targets involved in pulmonary vascular homeostasis, including microRNAs 424 and 503, connexins 37, and 40, and Kruppel Like Factors 2 and 4.
25087096 MEF2 transcription factors promotes epithelial-mesenchymal transition and invasiveness of hepatocellular carcinoma through TGF-beta1 autoregulation circuitry.
24879151 MEF2A is targeted to lysosomes for chaperone-mediated autophagy degradation; oxidative stress-induced lysosome destabilization leads to the disruption of MEF2A degradation as well as the dysregulation of its function
24043307 Correlation studies depicted two distinct groups of soft tissue sarcomas: one in which MEF2 repression correlates with PTEN downregulation and a second group in which MEF2 repression correlates with HDAC4 levels.
23955241 Phosphorylated DING (pDING) inhibits HIV-1 Tat-induced neuronal cell injury by suppressing the activity of serine/threonine kinases p38 MAPK and Cdk5 and enhancing the activity of neuroprotective factor MEF2 through the phosphotase activity of pDING
23461724 Mutations in MEF2A exon12 are implicated in pathogenesis of premature coronary artery disease in the Chinese population.
23382855 Substitution of any of the TFBS from our particular search of MEF2, CREB and SRF significantly decreased the number of identified clusters.
23224591 SENP2 plays an important role in determining the dynamics and functional outcome of MEF2A SUMOylation and transcriptional activation.
23028138 DNA methylation of genes in retinol metabolism and calcium signaling pathways (P < 3 x 10-6) and with known functions in muscle and T2D including MEF2A, RUNX1, NDUFC2, and THADA decreased after exercise
22484155 This study expands our understanding of the regulation of MEF2 in skeletal muscle and identifies the mAKAP scaffold as a facilitator of MEF2 transcription and myogenic differentiation.
22363637 The rare 21-bp deletion might have a more compelling effect on coronary artery disease (CAD) than the common (CAG)(n) polymorphism, and MEF2A genetic variant might be a rare but specific cause of CAD/myocardial infarction.
22028303 MEF2A dominant negative mutation enhanced cell proliferation and cell migration.
21767578 HCVne particles are capable of inducing the recently discovered ERK5 pathway, in a dose dependent way.
21741404 [review] In this work, the mechanisms of regulation of MEF2 function by several well-known neurotoxins and their implications in various neurodegenerative diseases are reviewed.
21468593 MEF2 positively regulates the expression of HZF1.
21450604 In a cohort of patients undergoing coronary angiography for suspected coronary artery disease the MEF2A exon 11 deletion occurred in 0.09%.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20590529 MEF2A and MEF2D play dual roles in human macrophages differentiation, as activators and as repressors of c-jun transcription.
20546016 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363751 ZAC1 is a novel and previously unknown regulator of cardiomyocyte Glut4 expression and glucose uptake; MEF2 is a regulator of ZAC1 expression in response to induction of hypertrophy
20132824 The current structure suggests that the ligand-binding pocket is not induced by cofactor binding but rather preformed by intrinsic folding.
20086047 Observational study of gene-disease association. (HuGE Navigator)
20031581 MEF2A is not a susceptibility gene for coronary artery disease and premature myocardial infarction in the Italian population.
20031581 Observational study of gene-disease association. (HuGE Navigator)
19935709 TGF-beta transcriptionally upregulated MMP-10 through activation of MEF2A, concomitant with acetylation of core histones increasing around the promoter, as a consequence of degradation of the class IIa HDACs.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19782985 These results identify MEF2A gene as a susceptibility gene for coronary artery disease.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19364819 novel interaction between the catalytic subunit of protein phosphatase 1alpha and MEF2A. Interaction occurs within the nucleus, and binding of PP1alpha to MEF2 potently represses MEF2-dependent transcription
19161138 rare MEF2A mutations did not contribute to the risk for LVH/HCM. However, the 11 repeats poly-Q allele could be a risk factor for LVH secondary to hypertension
19161138 Observational study of gene-disease association. (HuGE Navigator)
19153100 No Chinese Taiwanese coronary patients had Pro279Leu & 21-bp deletion mutations in exons 7 & 11 respectively. The distribution of the allele frequencies of MEF2A exon 11 CAG repeat (CAG)n polymorphism was similar in both patients and controls.
19153100 Observational study of gene-disease association. (HuGE Navigator)
19093215 MEF2 proteins are an important component in Galpha13-mediated angiogenesis.
19058854 These results suggest that the inhibitory effect of cAMP on IL-10 production by normal peripheral T lymphocytes is cell type and stimulus specific, exerted on multiple levels and involves MEF2 transcription factor.
18249389 Observational study of gene-disease association. (HuGE Navigator)
18222924 These findings support a role for MEF2A as an intermediary in coordinating respiratory chain subunit expression in heart and muscle through a NRF1 --> MEF2A --> COX(H) transcriptional cascade.
18160598 no association between MEF2A gene and premature myocardial infarction.
18160598 Observational study of gene-disease association. (HuGE Navigator)
18086930 Observational study of gene-disease association. (HuGE Navigator)
18086930 Studying independent samples of >1700 MI patients, 2 large control populations, and multiple families with apparently mendelian inheritance of the disease, no evidence was found for any linkage or association signal in the MEF2A gene.
18073218 Myocyte enhancer factor 2A is transcriptionally autoregulated in human and amphioxus
17611778 Overexpression of MEF2A is associated with hepatocellular carcinoma
17579569 Observational study of gene-disease association. (HuGE Navigator)
17579569 the CAG repeat polymorphism is associated with coronary heart disease in the Chinese population and the (CAG)9 allele may be an independent predictive factor for CAD
17112666 The MEF2A gene could be involved in the risk of developing late-onset Alzheimer's disease.
16980305 The role of ACTN4 in MEF2A transcription via HDAC7 antagonism is reported.
16951497 Observational study of gene-disease association. (HuGE Navigator)
16872533 Observational study of gene-disease association. (HuGE Navigator)
16872533 Delta7aa mutation was not detected in any individual within the study population and is unlikely to play a significant role in the development of IHD in Ireland
16767660 Mutations in exon 11 of MEF2A gene exist in the patients with coronary artery disease, and the mutations may be pathological.
16767660 Observational study of gene-disease association. (HuGE Navigator)
16563226 Our results suggest that protein sumoylation could play a pivotal role in controlling MEF2 transcriptional activity.
16504037 Study demonstrates that human intestinal cell BCMO1 expression is dependent on the functional cooperation between peroxisome proliferator-activated receptor-gamma and myocyte enhancer factor 2 isoforms.
16469744 data show a dosage-dependent cardiomyopathic phenotype and a progressive reduction in ventricular performance associated with MEF2A or MEF2C overexpression
16314281 Binding of this protein to DNA resulted in significant changes of its diffusion.
16195615 Observational study of gene-disease association. (HuGE Navigator)
16043483 MEF2/HAND1 interaction results in synergistic activation of MEF2-dependent promoters, and MEF2 binding sites are sufficient to mediate this synergy
15958500 Observational study of gene-disease association. (HuGE Navigator)
15958500 The genetic risk factor for myocardial infarction could be the result of a reduced transcriptional activity on MEF2A with 279Leu.
15861005 The MEF2A mutations may account for up to 1.93% of the disease population; thus, genetic testing based on mutational analysis of MEF2A may soon be available for many coronary artery disease/myocardial infarction patients.
15841183 Observational study of gene-disease association. (HuGE Navigator)
15841183 Results suggest that MEF2A mutations are not a common cause of coronary artery disease (CAD) in white people and argue strongly against a role for the MEF2A 21-bp deletion in autosomal dominant CAD.
15841171 Observational study of gene-disease association. (HuGE Navigator)
15834131 A conserved pattern of alternative splicing in vertebrate MEF2 (myocyte enhancer factor 2) genes generates an acidic activation domain in MEF2 proteins selectively in tissues where MEF2 target genes are highly expressed. (MEF2)
15811259 One disease-causing gene for CAD and MI has been identified as MEF2A, which is located on chromosome 15q26.3 and encodes a transcriptional factor with a high level of expression in coronary endothelium.
15798210 Myocyte enhancer factor 2 activates P2 promoter of the AbetaH-J-J locus.
15496429 Observational study of gene-disease association. (HuGE Navigator)
15466416 promoter- and cell-specific functional interaction between PITX2 and MEF2A
15084602 myogenin and myocyte enhancer factor-2 expression are triggered by membrane hyperpolarization during human myoblast differentiation
15057983 MEF2A is a candidate for chronic diaphragmatic hernia; it maps to chromosome 15.
15043778 Observational study of gene-disease association. (HuGE Navigator)
14960415 Activation of MEF2 in skeletal muscle is regulated via parallel intracellular signaling pathways in response to insulin, cellular stress, or activation of AMPK.
14645853 an autosomal dominant form of coronary artery disease/myocardial infarction (adCAD1) that is caused by the deletion of seven amino acids in transcription factor MEF2A is described
14630949 GEF and MEF2A have roles in regulating the GLUT4 promoter
12626519 MEF2a binding to HDAC5 is inhibited by HDAC5 when bound to Ca(2+)/calmodulin
12586839 identification of two aspects of MEF2 regulation, a highly conserved phosphoacceptor site and an indirect pathway of regulation by p38 MAPK
11792813 The C-terminal region in MEF2A contains signals that are necessary to localize the histone deacetylase 4/MEF2 complex to the nucleus.

AA Sequence

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF     71 - 140
SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS    141 - 210
TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPS    211 - 280
SKGMMPPLSEEEELELNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSAL    281 - 350
QGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ    351 - 420
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTE    421 - 490
DRESPSVKRMRMDAWVT                                                         491 - 507
//

Text Mined References (129)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26552705 2015 A p38 Mitogen-Activated Protein Kinase-Regulated Myocyte Enhancer Factor 2-?-Catenin Interaction Enhances Canonical Wnt Signaling.
26421691 2015 Linkage and whole genome sequencing identify a locus on 6q25-26 for formal thought disorder and implicate MEF2A regulation.
26400337 2015 Association of MEF2A gene 3'UTR mutations with coronary artery disease.
25809782 2015 Myocyte enhancer factor (MEF)-2 plays essential roles in T-cell transformation associated with HTLV-1 infection by stabilizing complex between Tax and CREB.
25655189 2015 Myocyte Enhancer Factor 2A Regulates Hydrogen Peroxide-Induced Senescence of Vascular Smooth Muscle Cells Via microRNA-143.
25366733 2014 MEF2A gene mutations and susceptibility to coronary artery disease in the Chinese population.
25336633 2015 Restoration of impaired endothelial myocyte enhancer factor 2 function rescues pulmonary arterial hypertension.
25087096 2014 MEF2 transcription factors promotes EMT and invasiveness of hepatocellular carcinoma through TGF-?1 autoregulation circuitry.
24879151 2014 Disruption of chaperone-mediated autophagy-dependent degradation of MEF2A by oxidative stress-induced lysosome destabilization.
24161931 2013 Nfat and miR-25 cooperate to reactivate the transcription factor Hand2 in heart failure.
24043307 2013 MEF2 is a converging hub for histone deacetylase 4 and phosphatidylinositol 3-kinase/Akt-induced transformation.
23461724 2013 Analysis of MEF2A mutations in a Chinese population with premature coronary artery disease.
23382855 2013 Enrichment of conserved synaptic activity-responsive element in neuronal genes predicts a coordinated response of MEF2, CREB and SRF.
23224591 2013 SENP2 regulates MEF2A de-SUMOylation in an activity dependent manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028138 2012 Impact of an exercise intervention on DNA methylation in skeletal muscle from first-degree relatives of patients with type 2 diabetes.
22484155 2012 Myocyte enhancer factor 2 (MEF2) tethering to muscle selective A-kinase anchoring protein (mAKAP) is necessary for myogenic differentiation.
22363637 2012 Variants in exon 11 of MEF2A gene and coronary artery disease: evidence from a case-control study, systematic review, and meta-analysis.
22028303 2012 The effects of myocyte enhancer factor 2A gene on the proliferation, migration and phenotype of vascular smooth muscle cells.
21767578 2011 MEK5/ERK5/mef2: a novel signaling pathway affected by hepatitis C virus non-enveloped capsid-like particles.
21741404 2011 Regulation of myocyte enhancer factor-2 transcription factors by neurotoxins.
21468593 Identification of HZF1 as a novel target gene of the MEF2 transcription factor.
21450604 2011 Exon 11 deletion in the myocyte enhancer factor (MEF)2A and early onset coronary artery disease gene in a Sicilian family.
21269460 2011 Initial characterization of the human central proteome.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20590529 2010 Dual roles for MEF2A and MEF2D during human macrophage terminal differentiation and c-Jun expression.
20546016 2010 Structural changes in exon 11 of MEF2A are not related to sporadic coronary artery disease in Han Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363751 2010 Regulation of cardiomyocyte Glut4 expression by ZAC1.
20132824 2010 Structure of the MADS-box/MEF2 domain of MEF2A bound to DNA and its implication for myocardin recruitment.
20086047 2010 Regulatory polymorphism in transcription factor KLF5 at the MEF2 element alters the response to angiotensin II and is associated with human hypertension.
20031581 2009 Association and functional analyses of MEF2A as a susceptibility gene for premature myocardial infarction and coronary artery disease.
19935709 2010 Transcriptional induction of MMP-10 by TGF-beta, mediated by activation of MEF2A and downregulation of class IIa HDACs.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19782985 2010 A study of the role of the Myocyte-specific Enhancer Factor-2A gene in coronary artery disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19364819 2009 Direct interaction between myocyte enhancer factor 2 (MEF2) and protein phosphatase 1alpha represses MEF2-dependent gene expression.
19161138 2009 Mutation analysis of the myocyte enhancer factor 2A gene (MEF2A) in patients with left ventricular hypertrophy/hypertrophic cardiomyopathy.
19153100 2010 CAG repeat polymorphism of the MEF2A gene is not associated with the risk of coronary artery disease among Taiwanese.
19093215 2009 Galpha13 regulates MEF2-dependent gene transcription in endothelial cells: role in angiogenesis.
19058854 2009 cAMP regulates IL-10 production by normal human T lymphocytes at multiple levels: a potential role for MEF2.
18697823 2008 Quantitative control of adaptive cardiac hypertrophy by acetyltransferase p300.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18249389 2008 Polymorphism in postinsulin receptor signaling pathway is not associated with polycystic ovary syndrome.
18222924 2008 Nuclear respiratory factor 1 controls myocyte enhancer factor 2A transcription to provide a mechanism for coordinate expression of respiratory chain subunits.
18160598 2008 MEF2A sequence variants in Turkish population.
18086930 2008 Lack of association between the MEF2A gene and myocardial infarction.
18073218 2008 Myocyte enhancer factor 2A is transcriptionally autoregulated.
17785444 2007 Nemo-like kinase-myocyte enhancer factor 2A signaling regulates anterior formation in Xenopus development.
17611778 2008 Overexpression of myocyte enhancer factor 2 and histone hyperacetylation in hepatocellular carcinoma.
17579569 2007 Relationship of the CAG repeat polymorphism of the MEF2A gene and coronary artery disease in a Chinese population.
17112666 2007 Myocyte enhancing factor-2A in Alzheimer's disease: genetic analysis and association with MEF2A-polymorphisms.
16980305 2006 Alpha-actinin 4 potentiates myocyte enhancer factor-2 transcription activity by antagonizing histone deacetylase 7.
16951497 2006 MEF2A gene and susceptibility to coronary artery disease in the Chinese people.
16872533 2006 Lack of MEF2A Delta7aa mutation in Irish families with early onset ischaemic heart disease, a family based study.
16767660 2006 [Study on novel mutations of MEF2A gene in Chinese patients with coronary artery disease].
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16563226 SUMO-1 modification of MEF2A regulates its transcriptional activity.
16504037 2006 Cooperation between MEF2 and PPARgamma in human intestinal beta,beta-carotene 15,15'-monooxygenase gene expression.
16484498 2006 A calcium-regulated MEF2 sumoylation switch controls postsynaptic differentiation.
16469744 2006 Myocyte enhancer factors 2A and 2C induce dilated cardiomyopathy in transgenic mice.
16381901 2006 The LIFEdb database in 2006.
16371476 2006 PDSM, a motif for phosphorylation-dependent SUMO modification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314281 2005 Monitoring the interaction between DNA and a transcription factor (MEF2A) using fluorescence correlation spectroscopy.
16195615 2005 Assessment of MEF2A mutations in myocardial infarction in Japanese patients.
16043483 2005 MEF2-dependent recruitment of the HAND1 transcription factor results in synergistic activation of target promoters.
15958500 2006 The Pro279Leu variant in the transcription factor MEF2A is associated with myocardial infarction.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15888658 2005 Cyclin-dependent kinase 5 mediates neurotoxin-induced degradation of the transcription factor myocyte enhancer factor 2.
15861005 2005 Molecular genetics of coronary artery disease.
15841183 2005 Lack of MEF2A mutations in coronary artery disease.
15841171 2005 MEF2A sequence variants and coronary artery disease: a change of heart?
15834131 2005 Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain.
15811259 2005 Advances in the genetic basis of coronary artery disease.
15798210 2005 Myocyte enhancer factor 2 activates promoter sequences of the human AbetaH-J-J locus, encoding aspartyl-beta-hydroxylase, junctin, and junctate.
15496429 2004 Transcription factor MEF2A mutations in patients with coronary artery disease.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466416 2004 Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15132737 2004 ERK5 is targeted to myocyte enhancer factor 2A (MEF2A) through a MAPK docking motif.
15084602 2004 Membrane hyperpolarization triggers myogenin and myocyte enhancer factor-2 expression during human myoblast differentiation.
15057983 2004 Congenital diaphragmatic hernia: is 15q26.1-26.2 a candidate locus?
15043778 2004 The association between paired basic amino acid cleaving enzyme 4 gene haplotype and diastolic blood pressure.
14960415 2004 MEF2 activation in differentiated primary human skeletal muscle cultures requires coordinated involvement of parallel pathways.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645853 2003 Mutation of MEF2A in an inherited disorder with features of coronary artery disease.
14630949 2003 Regulation of the human GLUT4 gene promoter: interaction between a transcriptional activator and myocyte enhancer factor 2A.
12691662 2003 Cdk5-mediated inhibition of the protective effects of transcription factor MEF2 in neurotoxicity-induced apoptosis.
12626519 2003 Direct interaction of Ca2+/calmodulin inhibits histone deacetylase 5 repressor core binding to myocyte enhancer factor 2.
12586839 2003 Phosphorylation motifs regulating the stability and function of myocyte enhancer factor 2A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371907 2003 p300/cAMP-response-element-binding-protein ('CREB')-binding protein (CBP) modulates co-operation between myocyte enhancer factor 2A (MEF2A) and thyroid hormone receptor-retinoid X receptor.
12061776 2002 TEF-1 and MEF2 transcription factors interact to regulate muscle-specific promoters.
11904443 2002 Dominant-interfering forms of MEF2 generated by caspase cleavage contribute to NMDA-induced neuronal apoptosis.
11792813 2001 The nuclear localization domain of the MEF2 family of transcription factors shows member-specific features and mediates the nuclear import of histone deacetylase 4.
11316766 2001 The MEF2A and MEF2D isoforms are differentially regulated in muscle and adipose tissue during states of insulin deficiency.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11160896 2001 Smad proteins function as co-modulators for MEF2 transcriptional regulatory proteins.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10852968 2000 Antiapoptotic role of the p38 mitogen-activated protein kinase-myocyte enhancer factor 2 transcription factor pathway during neuronal differentiation.
10849446 2000 Big mitogen-activated kinase regulates multiple members of the MEF2 protein family.
10835359 2000 Solution structure of the MEF2A-DNA complex: structural basis for the modulation of DNA bending and specificity by MADS-box transcription factors.
10825153 2000 Calcium regulates transcriptional repression of myocyte enhancer factor 2 by histone deacetylase 4.
10748098 2000 mHDA1/HDAC5 histone deacetylase interacts with and represses MEF2A transcriptional activity.
10737771 2000 Signal-dependent activation of the MEF2 transcription factor by dissociation from histone deacetylases.
10715212 2000 Crystal structure of MEF2A core bound to DNA at 1.5 A resolution.
10531066 1999 Neuronal activity-dependent cell survival mediated by transcription factor MEF2.
10487761 1999 HDAC4 deacetylase associates with and represses the MEF2 transcription factor.
10458488 1999 Expression of MEF2 genes during human cardiac development.
10330143 1999 Targeting of p38 mitogen-activated protein kinases to MEF2 transcription factors.
9858528 1999 Regulation of the MEF2 family of transcription factors by p38.
9753748 1998 Interaction of myocyte enhancer factor 2 (MEF2) with a mitogen-activated protein kinase, ERK5/BMK1.
9418854 1998 Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8798771 1996 MEF2 protein expression, DNA binding specificity and complex composition, and transcriptional activity in muscle and non-muscle cells.
8697817 1996 Structures and chromosome locations of the human MEF2A gene and a pseudogene MEF2AP.
8662987 1996 Functional and physical interactions between mammalian achaete-scute homolog 1 and myocyte enhancer factor 2A.
8575763 1995 Regional chromosomal assignments for four members of the MADS domain transcription enhancer factor 2 (MEF2) gene family to human chromosomes 15q26, 19p12, 5q14, and 1q12-q23.
8548800 1995 Cooperative activation of muscle gene expression by MEF2 and myogenic bHLH proteins.
7760790 1995 Regulatory role of MEF2D in serum induction of the c-jun promoter.
1748287 1991 Human SRF-related proteins: DNA-binding properties and potential regulatory targets.
1516833 1992 Human myocyte-specific enhancer factor 2 comprises a group of tissue-restricted MADS box transcription factors.
1329097 1992 Cyclic amplification and selection of targets for multicomponent complexes: myogenin interacts with factors recognizing binding sites for basic helix-loop-helix, nuclear factor 1, myocyte-specific enhancer-binding factor 2, and COMP1 factor.