Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVARPGEPAAARGGF      1 - 70
NVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTR     71 - 140
HPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGL    141 - 210
SNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLT    211 - 280
EPLLAELPFPSVLESEETPNQFI                                                   281 - 303
//

Text Mined References (7)

PMID Year Title