Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.76
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
14638676 the FLJ10193 protein, which we designate Med25, is a bona fide subunit of the mammalian Mediator complex

AA Sequence

MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH      1 - 70
NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM     71 - 140
FEIPKE                                                                    141 - 146
//

Text Mined References (11)

PMID Year Title
24952135 2014 RNA-Seq for the identification of novel Mediator transcripts in endothelial progenitor cells.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.