Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.20
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.800 2.5e-07
psoriasis 1.200 8.5e-09
osteosarcoma -1.413 1.5e-04
tuberculosis and treatment for 6 months -1.200 4.6e-06
group 3 medulloblastoma 1.100 3.8e-03
ovarian cancer 1.400 1.3e-03

Protein-protein Interaction (6)

Gene RIF (4)

PMID Text
18976975 Knockdown of MED8 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 8 (MED8) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16973571 ability to inhibit both host transcription and the interferon response is linked to interaction of NSs with the MED8 component of Mediator, a protein complex necessary for mRNA production
12149480 mammalian mediator subunit mMED8 is an elongin BC-interacting protein that can assemble with Cul2 and Rbx1 reconstitute a ubiquitin ligase (Ubc5; E2 ubiquitin-conjugating enzyme Ubc5)

AA Sequence

MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPL      1 - 70
FRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQI     71 - 140
QSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGA    141 - 210
GTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR                211 - 268
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21512757 2011 Screening and identification of host factors interacting with UL14 of herpes simplex virus 1.
21269460 2011 Initial characterization of the human central proteome.
21209843 2010 Nonsense mediated decay resistant mutations are a source of expressed mutant proteins in colon cancer cell lines with microsatellite instability.
20427562 2010 The N-terminus of Bunyamwera orthobunyavirus NSs protein is essential for interferon antagonism.
20194623 2010 MED14 tethers mediator to the N-terminal domain of peroxisome proliferator-activated receptor gamma and is required for full transcriptional activity and adipogenesis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
16973571 2006 Interaction of Bunyamwera Orthobunyavirus NSs protein with mediator protein MED8: a mechanism for inhibiting the interferon response.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
14576168 2003 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149480 2002 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11572939 2001 Analysis of Schizosaccharomyces pombe mediator reveals a set of essential subunits conserved between yeast and metazoan cells.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
9671713 1998 Mammalian mediator of transcriptional regulation and its possible role as an end-point of signal transduction pathways.