Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.38
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Rheumatoid Arthritis 1170 1.4e-02
aldosterone-producing adenoma 664 3.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Rheumatoid Arthritis -1.100 1.4e-02
aldosterone-producing adenoma -1.142 3.2e-02

Gene RIF (8)

PMID Text
25100719 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
25100719 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18976975 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18854154 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18854154 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED6 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 6 (MED6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYIL      1 - 70
LHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYH     71 - 140
PSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKE    141 - 210
AEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQ                                      211 - 246
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17641689 2007 MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation.
17000779 2006 Mediator modulates Gli3-dependent Sonic hedgehog signaling.
16595664 2006 Human Mediator enhances basal transcription by facilitating recruitment of transcription factor IIB during preinitiation complex assembly.
16574658 2006 Regulation of Aurora-A kinase gene expression via GABP recruitment of TRAP220/MED1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15808511 2005 PARP-1 determines specificity in a retinoid signaling pathway via direct modulation of mediator.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14983011 2004 The activator-recruited cofactor/Mediator coactivator subunit ARC92 is a functionally important target of the VP16 transcriptional activator.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
14576168 2003 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167862 2002 A component of the ARC/Mediator complex required for TGF beta/Nodal signalling.
12037571 2002 Transcription coactivator TRAP220 is required for PPAR gamma 2-stimulated adipogenesis.
11867769 2002 The TRAP/Mediator coactivator complex interacts directly with estrogen receptors alpha and beta through the TRAP220 subunit and directly enhances estrogen receptor function in vitro.
10993082 2000 TFIIH is negatively regulated by cdk8-containing mediator complexes.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
10198638 1999 Identity between TRAP and SMCC complexes indicates novel pathways for the function of nuclear receptors and diverse mammalian activators.
10024883 1999 A novel human SRB/MED-containing cofactor complex, SMCC, involved in transcription regulation.
9734358 1998 NAT, a human complex containing Srb polypeptides that functions as a negative regulator of activated transcription.
9671713 1998 Mammalian mediator of transcriptional regulation and its possible role as an end-point of signal transduction pathways.
9234719 1997 A transcriptional mediator protein that is required for activation of many RNA polymerase II promoters and is conserved from yeast to humans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.