Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.88
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Rheumatoid arthritis 1191 1.4e-02
aldosterone-producing adenoma 665 3.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.142 3.2e-02
Rheumatoid arthritis -1.100 1.4e-02

Gene RIF (8)

AA Sequence

MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYIL      1 - 70
LHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYH     71 - 140
PSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKE    141 - 210
AEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQ                                      211 - 246
//

Text Mined References (36)

PMID Year Title